DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and YKL107W

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_012815.1 Gene:YKL107W / 853753 SGDID:S000001590 Length:309 Species:Saccharomyces cerevisiae


Alignment Length:308 Identity:73/308 - (23%)
Similarity:127/308 - (41%) Gaps:58/308 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VIITGANSGIGKETAKDLAGRGARIIMACRNLETANAVKDEIVKETKNNKILVKKLDLGSQKSVR 119
            |.|.|...|:|:..:::||.|.||:.:      .....:||.:|:    ||...|.||......:
Yeast    26 VAIIGGTGGLGRAISRELAQRNARVTV------VGQTFRDEDLKD----KINFVKADLSLVSECK 80

  Fly   120 EFA-ADIVKTEPKIDVLIHNAGMALAFRGQTSEDGVELTMATNHYGPFLLTHLLIDVLKKSAPAR 183
            ..: :|.:..| ::..||...|:..:.:.|.:.:|:|..||.::...:::.|   ||.|:..   
Yeast    81 RISHSDEIPYE-ELTHLIFTTGIFASRQRQATSEGLEKDMAVSYLSRYIIFH---DVAKRLG--- 138

  Fly   184 IVIVASELYRLSSVNLAKLNPIGTFP------------------AAYLYYVSKFANIYFARE--- 227
                   :.|....:|.|:. |..||                  :||..:::..|    |.|   
Yeast   139 -------ISRTKKDDLPKVF-IAGFPGNGQVGDPDDLNSDEKKYSAYATHMNTVA----ANESLV 191

  Fly   228 LAKRLEGTKVTVNFLHPGMIDSGIWRNVPFPLNLPMMAITKGFFKTTKAGAQT---TI-YLATSN 288
            :..:...|.:....|:||:|.:.| ||.....:..:..||:.....|...|:|   || .|..|.
Yeast   192 IDAKDRYTNIDTFGLNPGLIKTNI-RNNLLGSDTYLSRITEWIISWTCQSAETYAKTICTLIASP 255

  Fly   289 EVANVSGKYFMDCKEATLNAAALDEEKGLKIWEESVKIVK--LTPQDP 334
            .:.:.||..|.:..:|.|.:..|.::...|..|.|..:|:  |..|.|
Yeast   256 AIESRSGTMFSNKGDAILPSPGLTKDVVEKFMENSELLVEKALRNQSP 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 69/297 (23%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 67/290 (23%)
YKL107WNP_012815.1 NADB_Rossmann 26..285 CDD:419666 66/288 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24320
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.