DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and AT1G64590

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_176640.1 Gene:AT1G64590 / 842767 AraportID:AT1G64590 Length:334 Species:Arabidopsis thaliana


Alignment Length:307 Identity:110/307 - (35%)
Similarity:162/307 - (52%) Gaps:17/307 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 FYLRITAGRCFTETKMEGKTVIITGANSGIGKETAKDLAGRGARIIMACRNLETANAVKDEIVKE 99
            |..|.||......:.:...|.|||||.||||.|||:.||.||||:::..|:::||...|..|:.|
plant    17 FGSRSTADHVTCNSDLRSLTAIITGATSGIGAETARVLAKRGARLVLPARSVKTAEETKARILSE 81

  Fly   100 TKNNKILVKKLDLGSQKSVREFAADIVKTEPKIDVLIHNAGMALAFRGQTSEDGVELTMATNHYG 164
            ..:.:|:|..|||.|..|||.|..|.......:::||:||| ..|.:...||||||:|.|||:.|
plant    82 FPDAEIIVMHLDLSSLTSVRRFVDDFESLNLPLNILINNAG-KYAHKHALSEDGVEMTFATNYLG 145

  Fly   165 PFLLTHLLIDVLKKSA-----PARIVIVASELYRLSS-------VNLAKLNPIGTFPAAYLYYVS 217
            .||||.||:..:.::|     ..|||.|.|.::...|       .::::.|  ..:.|...|.:|
plant   146 HFLLTKLLLKKMIETAAQTGVQGRIVNVTSVVHSWFSGDMLQYLADISRNN--RNYDATRAYALS 208

  Fly   218 KFANIYFARELAKRLE--GTKVTVNFLHPGMIDSGIWRNVPFPLNLPMMAITKGFFKTTKAGAQT 280
            |.||:....||::.|.  ...||.|.:|||::.:.:.|:....:...:..:|....|:....|.|
plant   209 KLANVLHTVELSRLLHKMDANVTANCVHPGIVKTRLTRDREGVVTDLVFFLTSKLLKSVPQAAAT 273

  Fly   281 TIYLATSNEVANVSGKYFMDCKEATLNAAALDEEKGLKIWEESVKIV 327
            |.|:|||..:.||.||||.||.||..:.:.....|..::|..|..:|
plant   274 TCYVATSPRLRNVCGKYFSDCNEARSSKSGSCNLKAQRLWTASDLLV 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 105/288 (36%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 103/281 (37%)
AT1G64590NP_176640.1 retinol-DH_like_SDR_c_like 36..313 CDD:212492 103/279 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 185 1.000 Inparanoid score I1413
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D1032903at2759
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - mtm1091
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24320
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.980

Return to query results.
Submit another query.