DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and POR C

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_171860.1 Gene:POR C / 839009 AraportID:AT1G03630 Length:401 Species:Arabidopsis thaliana


Alignment Length:361 Identity:119/361 - (32%)
Similarity:172/361 - (47%) Gaps:63/361 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VATLMSIRFYLR-------------ITAGRCFTETKMEGK------TVIITGANSGIGKETAKDL 72
            ::||::|:...|             :||.....|...|.|      |.:||||:||:|..|||.|
plant    45 ISTLLTIKEQRRQKPRFSTGIRAQTVTATPPANEASPEQKKTERKGTAVITGASSGLGLATAKAL 109

  Fly    73 AGRGA-RIIMACRN-LETANAVKDEIVKETKNNKILVKKLDLGSQKSVREFAADIVKTEPKIDVL 135
            |..|. .:|||||| |:...|.:.  |..:|.: ..|..|||.|.:||::|..:..:||..:|||
plant   110 ADTGKWHVIMACRNFLKAEKAARS--VGMSKED-YTVMHLDLASLESVKQFVENFRRTEQPLDVL 171

  Fly   136 IHNAGM--ALAFRGQTSEDGVELTMATNHYGPFLLTHLLIDVLKKS--APARIVIVASELYRLSS 196
            :.||.:  ..|.....:.:|.|:::.|||.|.|||:.||:|.||||  ...|::||.|.....::
plant   172 VCNAAVYQPTAKEPSFTAEGFEISVGTNHLGHFLLSRLLLDDLKKSDYPSKRMIIVGSITGNTNT 236

  Fly   197 V--------NLAKLNPI--------------GTFPAAYLYYVSKFANIYFARELAKRL-EGTKVT 238
            :        ||..|..:              |.|..|..|..||..|:...:||.:|. |.|.||
plant   237 LAGNVPPKANLGDLRGLASGLNGQNSSMIDGGEFDGAKAYKDSKVCNMLTMQELHRRYHEETGVT 301

  Fly   239 VNFLHPGMI-DSGIWR-NVP-FPLNLP--MMAITKGFFKTTKAGAQTTIYLATSNEVANVSGKYF 298
            ...|:||.| .:|::| ::| |.|..|  ...||||:....:||.:  :....|:.....||.|:
plant   302 FASLYPGCIATTGLFREHIPLFRLLFPPFQKYITKGYVSEEEAGKR--LAQVVSDPSLGKSGVYW 364

  Fly   299 -----MDCKEATLNAAALDEEKGLKIWEESVKIVKL 329
                 ....|..|:..|.|.||..|:||.|.|:|.|
plant   365 SWNNNSSSFENQLSKEASDAEKAKKLWEVSEKLVGL 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 109/319 (34%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 105/312 (34%)
POR CNP_171860.1 PLN00015 93..399 CDD:177654 107/310 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1032903at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.