DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and AT5G53100

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_200122.1 Gene:AT5G53100 / 835390 AraportID:AT5G53100 Length:364 Species:Arabidopsis thaliana


Alignment Length:356 Identity:102/356 - (28%)
Similarity:176/356 - (49%) Gaps:52/356 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GWLSTEHYVRDIFLMTSVAAIVATLMSIRFYLRITAGRCFTETKMEGKTVIITGANSGIGKETAK 70
            ||.:.   |::|.|.    .|:|:.:.|.|:|          ..:...|.|:||:.||||.|||:
plant    15 GWFNV---VQEILLQ----RIMASHLQIPFHL----------PPLNHLTCIVTGSTSGIGSETAR 62

  Fly    71 DLAGRGARIIMACRNLETANAVKDEIVKETKNN----------KILVKKLDLGSQKSVREFA-AD 124
            .||..||.::||.||::.|:    |::::.:..          .|...:|||.|..||..|: |.
plant    63 QLAEAGAHVVMAVRNIKAAH----ELIQQWQTKWSASGEGLPLNIQAMELDLLSLDSVVRFSNAW 123

  Fly   125 IVKTEPKIDVLIHNAGM-ALAFRGQTSEDGVELTMATNHYGPFLLTHLLIDVLKKSAPARIVIVA 188
            ..:..| :.|||:|||| |:....:.||||.|..|..||..|.||:.||:..|.:::.:||:.|.
plant   124 NARLAP-LHVLINNAGMFAMGGAQKFSEDGYEQHMQVNHLAPALLSLLLLPSLIRASRSRIINVN 187

  Fly   189 SELYRLSSVNLAKLNPIG---TFPAAYLYYVSKFANIYFARELAKRLE-GTKVTVNFLHPGMIDS 249
            |.::.:..|:...:|.:.   .|.:...|..||.|.:.|...|.|:|. .|.::|..|.||::.:
plant   188 SVMHYVGFVDPNDMNFVSGKRKFSSLSAYSSSKLAQVMFNNVLLKKLPLETGISVVCLSPGVVQT 252

  Fly   250 GIWRNVPFPLNLPMMAITKGFFKTTKAGAQTTIYLATSNEVANVSGK------------YFMDCK 302
            .|.|::| .|...:.:....|..:.:.|.:::::.||..::.|...|            ..::||
plant   253 NITRDLP-RLVQDLYSALPYFIFSPQEGCRSSLFSATDPQIPNHYQKLKTNEKSVCTLFISLNCK 316

  Fly   303 EATLNAAALDEEKGLKIWEESVKIVKLTPQD 333
            ....:..|.:.|...::||::::::.| |.|
plant   317 LTNCSEEAQNVETANRVWEKTLELIGL-PSD 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 89/302 (29%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 87/295 (29%)
AT5G53100NP_200122.1 PRK06197 46..342 CDD:235737 89/301 (30%)
NADB_Rossmann 48..334 CDD:304358 86/291 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24320
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.