DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and AT5G53090

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_200121.4 Gene:AT5G53090 / 835389 AraportID:AT5G53090 Length:375 Species:Arabidopsis thaliana


Alignment Length:300 Identity:91/300 - (30%)
Similarity:156/300 - (52%) Gaps:22/300 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 TVIITGANSGIGKETAKDLAGRGARIIMACRNLETANAVKDEIVKETKNNKILVK----KLDLGS 114
            |.|:||:.||||:|||:.||..|||::||.||.:.|:.:..:..||.....|.:.    :|||.|
plant    58 TCIVTGSTSGIGRETARQLAEAGARVVMAVRNTKAAHELIQQWQKEWSGKGIPLNLEAMELDLLS 122

  Fly   115 QKSVREFAADIVKTEPKIDVLIHNAGM-ALAFRGQTSEDGVELTMATNHYGPFLLTHLLIDVLKK 178
            ..||..|..........:.|||:|||: ::....:.|:||.|..|..||..|.||:.||:..|.:
plant   123 LDSVVGFCNLWNARLSPLHVLINNAGIFSMGEEQKFSKDGYEQHMQVNHLAPALLSLLLLPSLIR 187

  Fly   179 SAPARIVIVASELYRLSSVNLAKLNPIG---TFPAAYLYYVSKFANIYFARELAKRLE-GTKVTV 239
            .:|:||:.|.|.::.:..|:...:|.:.   .|.:...|..||.|.:.|:..|.|||. .|:::|
plant   188 GSPSRIINVNSVMHYVGFVDPDDMNVVSGKRKFTSLVGYSGSKLAQVMFSNVLLKRLPLETRISV 252

  Fly   240 NFLHPGMIDSGIWRNVPFPLNLPMMAITKGFFKTTKAGAQTTIYLATSNEVANVSGK-------- 296
            ..|.||::.:.:.|::|..:.: ..|:...|..:.:.|:::|::.||..::.....|        
plant   253 VCLSPGIVLTNVARDLPRYVQV-QYALIPYFIFSPQEGSRSTLFSATDAQIPEHCEKLKTEDKPV 316

  Fly   297 ---YFMDCKEATLNAAALDEEKGLKIWEESVKIVKLTPQD 333
               ...:||....:..|.:.|...::||:::|::.| |.|
plant   317 CTFISQNCKHTKPSEEAHNVETAERVWEKTIKLIGL-PLD 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 88/292 (30%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 85/285 (30%)
AT5G53090NP_200121.4 NADB_Rossmann 60..343 CDD:419666 84/283 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24320
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.