DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and AT5G02540

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_568102.1 Gene:AT5G02540 / 831913 AraportID:AT5G02540 Length:331 Species:Arabidopsis thaliana


Alignment Length:288 Identity:108/288 - (37%)
Similarity:161/288 - (55%) Gaps:20/288 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 TVIITGANSGIGKETAKDLAGRGARIIMACRNLETANAVKDEIVKETKNNKILVKKLDLGSQKSV 118
            |.||||...|||.|||:.|:.|||.:::..||:..|...|.||:::..|.::.:.:|||.|.||:
plant    35 TAIITGGTGGIGMETARVLSKRGAHVVIGARNMGAAENAKTEILRQNANARVTLLQLDLSSIKSI 99

  Fly   119 REFAADIVKTEPKIDVLIHNAGMALAFRGQTSEDGVELTMATNHYGPFLLTHLLIDVLKKSA--- 180
            :.|..:.......:::||:|||:... ..|.||||:||..||||.|.||||:||:|.:|.:|   
plant   100 KAFVREFHALHLPLNLLINNAGVMFC-PYQLSEDGIELQFATNHIGHFLLTNLLLDTMKNTAKTS 163

  Fly   181 --PARIVIVAS--ELYRL-SSVNLAKLNPIGTFPAAYLYYVSKFANIYFARELAKRL--EGTKVT 238
              ..||:.|:|  .:|.. ..:....:|.|.::.....|..||.|||..|.||:::|  ||..:|
plant   164 GVEGRILNVSSVAHIYTYQEGIQFDSINDICSYSDKRAYGQSKLANILHANELSRQLQEEGVNIT 228

  Fly   239 VNFLHPGMIDSGIWRNVPFPLNLPMMAITKGF----FKTTKAGAQTTIYLATSNEVANVSGKYFM 299
            .|.:|||:|.:.::::...     :|...|.|    :|....||.||.|:|....|..|:||||.
plant   229 ANSVHPGLILTNLFQHTAL-----LMRFLKFFSFYLWKNIPQGAATTCYVALHPSVKGVTGKYFA 288

  Fly   300 DCKEATLNAAALDEEKGLKIWEESVKIV 327
            ||.|.|.:..|.||....|:|:.|||::
plant   289 DCNEVTPSKLARDETLAQKLWDFSVKLI 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 108/286 (38%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 104/279 (37%)
AT5G02540NP_568102.1 PRK06196 14..315 CDD:235736 107/285 (38%)
retinol-DH_like_SDR_c_like 48..309 CDD:212492 96/266 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 171 1.000 Domainoid score I1148
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - mtm1091
orthoMCL 1 0.900 - - OOG6_100091
Panther 1 1.100 - - O PTHR24320
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.820

Return to query results.
Submit another query.