DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and FEY

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_194506.4 Gene:FEY / 828890 AraportID:AT4G27760 Length:376 Species:Arabidopsis thaliana


Alignment Length:308 Identity:90/308 - (29%)
Similarity:156/308 - (50%) Gaps:38/308 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 TVIITGANSGIGKETAKDLAGRGARIIMACRNLETANAVKDEIVKETKNN--------KILVKKL 110
            |.::||:.||||:|||:.||..||.::||.||.:.|    .|::.:.:|.        .|...::
plant    59 TCVVTGSTSGIGRETARQLAEAGAHVVMAVRNTKAA----QELILQWQNEWSGKGLPLNIEAMEI 119

  Fly   111 DLGSQKSVREFAADIVKTEPKIDVLIHNAGM-ALAFRGQTSEDGVELTMATNHYGPFLLTHLLID 174
            ||.|..||..||.........:.|||:|||| |:....:.||:|.|..|..||..|.||:.||:.
plant   120 DLLSLDSVARFAEAFNARLGPLHVLINNAGMFAMGEAQKFSEEGYEQHMQVNHLAPALLSVLLLP 184

  Fly   175 VLKKSAPARIVIVASELYRLSSVNLAKLNPIG---TFPAAYLYYVSKFANIYFARELAKRLE-GT 235
            .|.:.:|:||:.|.|.::.:..|:...:|.:.   .:.:...|..||.|.|.|:..|.|:|. .|
plant   185 SLIRGSPSRIINVNSVMHSVGFVDPDDMNVVSGRRKYSSLIGYSSSKLAQIMFSSILFKKLPLET 249

  Fly   236 KVTVNFLHPGMIDSGIWRNVPFPLNLPMMAITKGFFKTTKAGAQTTIYLATSNEVANVSGKYF-- 298
            .|:|..|.||::.:.:.|::...|. .:.|:...|..:.:.|.:::::.||..::.    :|:  
plant   250 GVSVVCLSPGVVLTNVARDLSRILQ-ALYAVIPYFIFSPQEGCRSSLFSATDPQIP----EYWET 309

  Fly   299 -------------MDCKEATLNAAALDEEKGLKIWEESVKIVKLTPQD 333
                         .||:.|..:..|.:.|...::|::::::|.| |.|
plant   310 LKNDDWPVCPFISQDCRPANPSEEAHNTETAQRVWKKTLELVGL-PLD 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 86/300 (29%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 85/293 (29%)
FEYNP_194506.4 SDR 61..344 CDD:330230 84/291 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24320
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.