DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and PORB

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001031731.1 Gene:PORB / 828853 AraportID:AT4G27440 Length:401 Species:Arabidopsis thaliana


Alignment Length:355 Identity:118/355 - (33%)
Similarity:170/355 - (47%) Gaps:72/355 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 MSIRFYLRITAGRCFTETKMEGK------TVIITGANSGIGKETAKDLAGRGA-RIIMACRN-LE 87
            ::||.....|:....|:: ::||      .|::|||:||:|..|||.||..|. .:|||||: |:
plant    62 LAIRAQTAATSSPTVTKS-VDGKKTLRKGNVVVTGASSGLGLATAKALAETGKWNVIMACRDFLK 125

  Fly    88 TANAVKDEIVKETKNNKILVKKLDLGSQKSVREFAADIVKTEPKIDVLIHNAGM--ALAFRGQTS 150
            ...|.|.  |...|:: ..|..|||.|..|||:|..:..:||..:|||:.||.:  ..|.....|
plant   126 AERAAKS--VGMPKDS-YTVMHLDLASLDSVRQFVDNFRRTETPLDVLVCNAAVYFPTAKEPTYS 187

  Fly   151 EDGVELTMATNHYGPFLLTHLLIDVLKKS--APARIVIVASELYRLSSV--------NLAKLNPI 205
            .:|.||::||||.|.|||..||:|.||||  ...|::||.|.....:::        ||..|..:
plant   188 AEGFELSVATNHLGHFLLARLLLDDLKKSDYPSKRLIIVGSITGNTNTLAGNVPPKANLGDLRGL 252

  Fly   206 ---------------GTFPAAYLYYVSKFANIYFARELAKRL-EGTKVTVNFLHPGMIDS-GIWR 253
                           |.|..|..|..||..|:...:|..:|. |.|.||...|:||.|.| |::|
plant   253 AGGLNGLNSSAMIDGGDFDGAKAYKDSKVCNMLTMQEFHRRFHEETGVTFASLYPGCIASTGLFR 317

  Fly   254 -NVP-----FPLNLPMMA-ITKGFFKTTKAG------------AQTTIYLATSNEVANVSGKYFM 299
             ::|     ||   |... ||||:...|::|            .::.:|.:.:|..|:.      
plant   318 EHIPLFRALFP---PFQKYITKGYVSETESGKRLAQVVSDPSLTKSGVYWSWNNASASF------ 373

  Fly   300 DCKEATLNAAALDEEKGLKIWEESVKIVKL 329
               |..|:..|.|.||..|:||.|.|:|.|
plant   374 ---ENQLSEEASDVEKARKVWEISEKLVGL 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 112/330 (34%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 108/323 (33%)
PORBNP_001031731.1 PLN00015 92..399 CDD:177654 109/321 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1032903at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.