DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and AT4G23420

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001190811.1 Gene:AT4G23420 / 828441 AraportID:AT4G23420 Length:333 Species:Arabidopsis thaliana


Alignment Length:286 Identity:115/286 - (40%)
Similarity:163/286 - (56%) Gaps:13/286 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GKTVIITGANSGIGKETAKDLAGRGARIIMACRNLETANAVKDEIVKETKNNKILVKKLDLGSQK 116
            |.|.|:|||:||||.|||:.||.||..::||.||......||::|||:....|:.|.:|:|.|.:
plant    46 GLTAIVTGASSGIGVETARVLALRGVHVVMAVRNTGAGAKVKEDIVKQVPGAKVDVMELELSSME 110

  Fly   117 SVREFAADIVKTEPKIDVLIHNAG-MALAFRGQTSEDGVELTMATNHYGPFLLTHLLIDVLKKSA 180
            |||:||::.......:::||:||| ||..|  ..|:|.:||..||||.|.||||.||:|.:|.::
plant   111 SVRKFASEYKSAGLPLNLLINNAGIMACPF--MLSKDNIELQFATNHLGHFLLTKLLLDTMKNTS 173

  Fly   181 -----PARIVIVASELYRLS---SVNLAKLNPIGTFPAAYLYYVSKFANIYFARELAKRL--EGT 235
                 ..|||.|:||.:|.|   .|...|:|...::.:...|..||..|:..|.||||:|  :|.
plant   174 RESKREGRIVNVSSEAHRYSYPEGVRFDKINDESSYSSIRAYGQSKLCNVLHANELAKQLKEDGV 238

  Fly   236 KVTVNFLHPGMIDSGIWRNVPFPLNLPMMAITKGFFKTTKAGAQTTIYLATSNEVANVSGKYFMD 300
            .:|.|.||||.|.:.:|......|...:.|:.|...|:...||.||.|:|.:.:||.|:|:||.|
plant   239 NITANSLHPGAIMTNLWGYFNSYLAGAVGAVAKYMVKSVPQGAATTCYVALNPQVAGVTGEYFSD 303

  Fly   301 CKEATLNAAALDEEKGLKIWEESVKI 326
            ...|.......|.|...|:|:.|.|:
plant   304 SNIAKPIELVKDTELAKKLWDFSTKL 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 115/286 (40%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 112/278 (40%)
AT4G23420NP_001190811.1 PRK06197 43..331 CDD:235737 115/286 (40%)
retinol-DH_like_SDR_c_like 46..323 CDD:212492 112/278 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 171 1.000 Domainoid score I1148
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - mtm1091
orthoMCL 1 0.900 - - OOG6_100091
Panther 1 1.100 - - O PTHR24320
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.820

Return to query results.
Submit another query.