DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and DHRS12

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001364858.1 Gene:DHRS12 / 79758 HGNCID:25832 Length:320 Species:Homo sapiens


Alignment Length:213 Identity:67/213 - (31%)
Similarity:109/213 - (51%) Gaps:15/213 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ETKMEGKTVIITGANSGIGKETAKDLAGRGARIIMACRNLETANAVKDEIVKETKNNKILVKKLD 111
            |.::.|:..::||.||||||.||.::|.||..:.:.||:...|...:.||::|:.|..|.:..:|
Human    35 EVQIPGRVFLVTGGNSGIGKATALEIAKRGGTVHLVCRDQAPAEDARGEIIRESGNQNIFLHIVD 99

  Fly   112 LGSQKSVREFAADIVKTEPKIDVLIHNAGMALAFRGQTSEDGVELTMATNHYGPFLLTHLLIDVL 176
            |...|.:.:|..:. |.|.|:.|||:||| .:..:.:.:|||:|...|.|..|.::||..||.||
Human   100 LSDPKQIWKFVENF-KQEHKLHVLINNAG-CMVNKRELTEDGLEKNFAANTLGVYILTTGLIPVL 162

  Fly   177 KKSAPARIVIVASELYRLSSVNLAKLNPIGT-FPAAYLYYVSKFANIYFARELAKRLEGTKVTVN 240
            :|....|::.|:|....:..:|...|....| |....:|..:|...:.    |.:|.......::
Human   163 EKEHDPRVITVSSGGMLVQKLNTNDLQSERTPFDGTMVYAQNKRQQVV----LTERWAQGHPAIH 223

  Fly   241 F--LHPGMIDSGIWRNVP 256
            |  :|||      |.:.|
Human   224 FSSMHPG------WADTP 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 66/208 (32%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 66/208 (32%)
DHRS12NP_001364858.1 NADB_Rossmann 40..>235 CDD:419666 65/206 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.