DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and 1700003E16Rik

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_082224.1 Gene:1700003E16Rik / 71837 MGIID:1919087 Length:598 Species:Mus musculus


Alignment Length:144 Identity:32/144 - (22%)
Similarity:53/144 - (36%) Gaps:31/144 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 LSSVNLAKLNPIGTFPAAYLYYVSKFANIYFARELA--KRLEGTKVTVNFLHPGMIDSGIWRNVP 256
            ::|....||.|:..:|:.:.....:...::..|...  :..|..:||     |...||| |    
Mouse   446 VASTPTPKLWPLAKWPSGWEREAEQLGELWAGRTRVPPQGQEPVEVT-----PLEEDSG-W---- 500

  Fly   257 FPLNLPMMAITKGFFKTTKAGAQTTIYLATSNEVANVSGKYFMDCKEATLNAAALDEEKGLKIWE 321
             ||..|.:     ...|::...:..:...|...|..||  .:....:..||.|.:.:|.     |
Mouse   501 -PLAAPQV-----LEATSQVLWKPMVISETMKLVPGVS--MWNRGTQELLNPAVIRKEA-----E 552

  Fly   322 ESVKIVKLTPQDPK 335
            |.      |||.|:
Mouse   553 EG------TPQAPE 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 28/134 (21%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 26/127 (20%)
1700003E16RikNP_082224.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
DUF4639 6..571 CDD:292118 32/144 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..190
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 222..241
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 366..396
LamG <436..>463 CDD:304605 5/16 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 551..571 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.