DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and 1700003E16Rik

DIOPT Version :10

Sequence 1:NP_650717.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_082224.1 Gene:1700003E16Rik / 71837 MGIID:1919087 Length:598 Species:Mus musculus


Alignment Length:144 Identity:32/144 - (22%)
Similarity:53/144 - (36%) Gaps:31/144 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 LSSVNLAKLNPIGTFPAAYLYYVSKFANIYFARELA--KRLEGTKVTVNFLHPGMIDSGIWRNVP 256
            ::|....||.|:..:|:.:.....:...::..|...  :..|..:||     |...||| |    
Mouse   446 VASTPTPKLWPLAKWPSGWEREAEQLGELWAGRTRVPPQGQEPVEVT-----PLEEDSG-W---- 500

  Fly   257 FPLNLPMMAITKGFFKTTKAGAQTTIYLATSNEVANVSGKYFMDCKEATLNAAALDEEKGLKIWE 321
             ||..|.:     ...|::...:..:...|...|..||  .:....:..||.|.:.:|.     |
Mouse   501 -PLAAPQV-----LEATSQVLWKPMVISETMKLVPGVS--MWNRGTQELLNPAVIRKEA-----E 552

  Fly   322 ESVKIVKLTPQDPK 335
            |.      |||.|:
Mouse   553 EG------TPQAPE 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_650717.1 retinol-DH_like_SDR_c_like 52..320 CDD:212492 26/127 (20%)
1700003E16RikNP_082224.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
DUF4639 6..571 CDD:464739 32/144 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..190
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 222..241
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 366..396
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 551..571 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.