DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and dhrs12la

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_987120.1 Gene:dhrs12la / 677747 ZFINID:ZDB-GENE-030131-8104 Length:320 Species:Danio rerio


Alignment Length:302 Identity:95/302 - (31%)
Similarity:153/302 - (50%) Gaps:24/302 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ITAGRCFT----ETKMEGKTVIITGANSGIGKETAKDLAGRGARIIMACRNLETANAVKDEIVKE 99
            ::|.:.|.    ||.|.|::.:||||||||||..|..:|.:|..:.|.|||.:.|...:.|||||
Zfish    23 LSASKNFVEKDLETSMAGRSFMITGANSGIGKAAAMAIAKKGGTVHMVCRNKDKAEEARAEIVKE 87

  Fly   100 TKNNKILVKKLDLGSQKSVREFAADIVKTEPKIDVLIHNAGMALAFRGQTSEDGVELTMATNHYG 164
            :.|.:|.|..|||...|.|.||.....|....::|||:|||..:..| :.:.:|:|.:.|:|...
Zfish    88 SGNKEIYVHILDLSETKKVWEFVESFKKKYKTLNVLINNAGCMMTKR-EVNGEGLEKSFASNSLA 151

  Fly   165 PFLLTHLLIDVLKKSAPARIVIVASE---LYRLSSVNLAKLNPIGTFPAAYLYYVSKFANIYFAR 226
            .|:....||.:|:||...|::.|:|.   :.:|.:.||....  |.:....:|..:|...:....
Zfish   152 VFIFIKSLIPLLEKSPDPRVITVSSGGMLVQKLRTGNLQSQR--GRYDGTMVYAQNKRQQVVMTE 214

  Fly   227 ELAKRLEGTKVTVNFLHPGMIDSGIWRNVPFPLNLPMMAITKGFFKTTKAGAQTTIYLATSNEVA 291
            :.||.......:|  :|||.:|:....|.....:..|    |...:||:.||.|.::||.|...|
Zfish   215 QFAKAHPSIHFSV--MHPGWVDTPTIANAMPDFHSSM----KERLRTTEQGADTVVWLAVSEAAA 273

  Fly   292 -NVSGKYFMDCKE-------ATLNAAALDEEKGLKIWEESVK 325
             |.||:::.|.|.       |..:::.|:::|.:.:.|:..|
Zfish   274 KNPSGRFYQDRKMVSAHLPLAWTHSSQLEDQKFMSVMEDLAK 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 90/285 (32%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 88/278 (32%)
dhrs12laNP_987120.1 FabG 37..273 CDD:223959 80/244 (33%)
DHRS-12_like_SDR_c-like 40..294 CDD:187668 85/262 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.