DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and RDH14

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_065956.1 Gene:RDH14 / 57665 HGNCID:19979 Length:336 Species:Homo sapiens


Alignment Length:335 Identity:141/335 - (42%)
Similarity:203/335 - (60%) Gaps:29/335 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SVAAIVATLMSIRFYLRITAGRCFTETK------------MEGKTVIITGANSGIGKETAKDLAG 74
            :||...|.|.::...|.:.|.| |...:            |.||||:|||||||:|:.||.:|..
Human     2 AVATAAAVLAALGGALWLAARR-FVGPRVQRLRRGGDPGLMHGKTVLITGANSGLGRATAAELLR 65

  Fly    75 RGARIIMACRNLETANAVKDEIVKETKN-------------NKILVKKLDLGSQKSVREFAADIV 126
            .|||:||.||:...|.....::.:|.:.             .:::|::|||.|.:|||.|..:::
Human    66 LGARVIMGCRDRARAEEAAGQLRRELRQAAECGPEPGVSGVGELIVRELDLASLRSVRAFCQEML 130

  Fly   127 KTEPKIDVLIHNAGMALAFRGQTSEDGVELTMATNHYGPFLLTHLLIDVLKKSAPARIVIVASEL 191
            :.||::||||:|||:......:| |||.|:....||.|.||||:||:.:||.|||:|||:|:|:|
Human   131 QEEPRLDVLINNAGIFQCPYMKT-EDGFEMQFGVNHLGHFLLTNLLLGLLKSSAPSRIVVVSSKL 194

  Fly   192 YRLSSVNLAKLNPIGTFPAAYLYYVSKFANIYFARELAKRLEGTKVTVNFLHPGMIDSGIWRNVP 256
            |:...:|...||...::..::.|..||.|||.|.||||:|||||.||||.||||::.:.:.|::.
Human   195 YKYGDINFDDLNSEQSYNKSFCYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIH 259

  Fly   257 FPLNL-PMM-AITKGFFKTTKAGAQTTIYLATSNEVANVSGKYFMDCKEATLNAAALDEEKGLKI 319
            .||.: |:. .::..||||...||||:||||:|.||..|||:||.||||..|...|:||....|:
Human   260 IPLLVKPLFNLVSWAFFKTPVEGAQTSIYLASSPEVEGVSGRYFGDCKEEELLPKAMDESVARKL 324

  Fly   320 WEESVKIVKL 329
            |:.|..:|.|
Human   325 WDISEVMVGL 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 130/289 (45%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 128/282 (45%)
RDH14NP_065956.1 retinol-DH_like_SDR_c 43..328 CDD:212495 129/285 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 1 1.100 - - O PTHR24320
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.