DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and dhrs12

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001070025.1 Gene:dhrs12 / 556393 ZFINID:ZDB-GENE-060929-1134 Length:318 Species:Danio rerio


Alignment Length:296 Identity:88/296 - (29%)
Similarity:150/296 - (50%) Gaps:23/296 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 AGRCFT----ETKMEGKTVIITGANSGIGKETAKDLAGRGARIIMACRNLETANAVKDEIVKETK 101
            |.|.||    :..:.|::.|||||||||||..|.::|.||..:.:.|||.:.|...:.:||:::|
Zfish    25 AERRFTPADLDVSVNGRSFIITGANSGIGKAAAYEIAKRGGTVHLVCRNKDRAEEARKDIVEQSK 89

  Fly   102 NNKILVKKLDLGSQKSVREFAADIVKTEPKIDVLIHNAGMALAFRGQTSEDGVELTMATNHYGPF 166
            :..:.|..:|:.|.:.|.|||:...:.. .:.|||:|||..:..| :.:|||:|...|||..|.:
Zfish    90 SENVHVHLVDMSSPRKVWEFASGFSQNH-NLHVLINNAGCMVNQR-ELTEDGLEKNFATNTLGTY 152

  Fly   167 LLTHLLIDVLKKSAPARIVIVASELYRLSSVNLAKLN-PIGTFPAAYLYYVSKFANIYFARELAK 230
            :||..||..||:|...|::.|:|....:..:|:..|. ..|:|.....|..:|...:....:.| 
Zfish   153 ILTTALIPTLKRSENPRVITVSSGGMLVQKLNVEDLQFEKGSFDGTMAYAQNKRQQVIMTEQWA- 216

  Fly   231 RLEGTKVTVNFLHPGMIDSGIWRNVPFPLNLP-MMAITKGFFKTTKAGAQTTIYLATSNEVA-NV 293
             .:..::..:.:|||..|:...|:     ::| .....|...:|...||.|.::||.|:..: ..
Zfish   217 -TQHKEIHFSSMHPGWADTPAVRS-----SMPDFYEKMKNKLRTEAQGADTVVWLAVSDAASRQP 275

  Fly   294 SGKYFMDCKEATLN-------AAALDEEKGLKIWEE 322
            ||.:|.|.|..:.:       ....:::|.:.:.||
Zfish   276 SGLFFQDRKAVSTHLPLAFSKTPPAEDQKLVNLLEE 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 84/281 (30%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 82/277 (30%)
dhrs12NP_001070025.1 FabG 39..273 CDD:223959 76/242 (31%)
NADB_Rossmann 40..293 CDD:304358 81/261 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.