DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and WWOX

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_057457.1 Gene:WWOX / 51741 HGNCID:12799 Length:414 Species:Homo sapiens


Alignment Length:301 Identity:109/301 - (36%)
Similarity:160/301 - (53%) Gaps:17/301 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LRITAGRCFTETKMEGKTVIITGANSGIGKETAKDLAGRGARIIMACRNLETANAVKDEIVKETK 101
            :.|..||.||     ||.|::||||||||.||||..|..||.:|:||||:..|:.....|::|..
Human   114 MEILQGRDFT-----GKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWH 173

  Fly   102 NNKILVKKLDLGSQKSVREFAADIVKTEPKIDVLIHNAGMALAFRGQTSEDGVELTMATNHYGPF 166
            ..|:....|||...:||:.||.........:.||:.||. ..|.....::||:|.|...||.|.|
Human   174 KAKVEAMTLDLALLRSVQHFAEAFKAKNVPLHVLVCNAA-TFALPWSLTKDGLETTFQVNHLGHF 237

  Fly   167 LLTHLLIDVLKKSAPARIVIVASELYRLSSVN-------LAKLNPI-GTFPAAYLYYVSKFANIY 223
            .|..||.|||.:|||||:::|:||.:|.:.:|       .::|:|. ..:.|...|..||..||.
Human   238 YLVQLLQDVLCRSAPARVIVVSSESHRFTDINDSLGKLDFSRLSPTKNDYWAMLAYNRSKLCNIL 302

  Fly   224 FARELAKRLEGTKVTVNFLHPG-MIDSGIWRNVPFPLNLPMMAITKGFFKTTKAGAQTTIYLATS 287
            |:.||.:||....||.|.:||| |:.|.|.|:  :.:...:..:.:.|.|:.:.||.||:|.|..
Human   303 FSNELHRRLSPRGVTSNAVHPGNMMYSNIHRS--WWVYTLLFTLARPFTKSMQQGAATTVYCAAV 365

  Fly   288 NEVANVSGKYFMDCKEATLNAAALDEEKGLKIWEESVKIVK 328
            .|:..:.|.||.:|.....:..|..||....:|..|.::::
Human   366 PELEGLGGMYFNNCCRCMPSPEAQSEETARTLWALSERLIQ 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 104/283 (37%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 102/276 (37%)
WWOXNP_057457.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
WW 19..47 CDD:238122
Nuclear localization signal. /evidence=ECO:0000250 50..55
WW 60..90 CDD:238122
human_WWOX_like_SDR_c-like 124..407 CDD:187669 104/286 (36%)
Interaction with MAPT. /evidence=ECO:0000250 125..414 103/285 (36%)
Mediates targeting to the mitochondria. /evidence=ECO:0000250 209..273 27/64 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.