DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and RDH11

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_057110.3 Gene:RDH11 / 51109 HGNCID:17964 Length:318 Species:Homo sapiens


Alignment Length:312 Identity:123/312 - (39%)
Similarity:186/312 - (59%) Gaps:11/312 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FLMTSVAAIVATLMSIRFYLRITAGRCFTETKMEGKTVIITGANSGIGKETAKDLAGRGARIIMA 82
            ||:...|..:..::|        :|.|.:..::.||.|::||||:||||||||:||.||||:.:|
Human    15 FLLYMAAPQIRKMLS--------SGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGARVYLA 71

  Fly    83 CRNLETANAVKDEIVKETKNNKILVKKLDLGSQKSVREFAADIVKTEPKIDVLIHNAGMALAFRG 147
            ||::|....|..||...|.|.::||:||||...||:|.||...:..|..:.|||:|||:.:....
Human    72 CRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYS 136

  Fly   148 QTSEDGVELTMATNHYGPFLLTHLLIDVLKKSAPARIVIVASELYRLSSVNLAKLNPIGTFPAAY 212
            :|: ||.|:.:..||.|.|||||||::.||:|||:|||.|:|..:.|..::...|.....:.|..
Human   137 KTA-DGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGL 200

  Fly   213 LYYVSKFANIYFARELAKRLEGTKVTVNFLHPGMIDSGIWRNVPFPLNLPMMAITKGFFKTTKAG 277
            .|..||.|||.|.:|||:||:|:.||...:|||.:.|.:.|:..|  ...|..:...|.||.:.|
Human   201 AYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSELVRHSSF--MRWMWWLFSFFIKTPQQG 263

  Fly   278 AQTTIYLATSNEVANVSGKYFMDCKEATLNAAALDEEKGLKIWEESVKIVKL 329
            |||:::.|.:..:..:||.:|.||..|.::|.|.:|....::|:.|..::.|
Human   264 AQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIARRLWDVSCDLLGL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 116/274 (42%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 114/267 (43%)
RDH11NP_057110.3 PRK06197 41..314 CDD:235737 116/275 (42%)
NADB_Rossmann 41..309 CDD:304358 115/270 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D1032903at2759
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.