DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and LOC500227

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_038964083.1 Gene:LOC500227 / 500227 RGDID:1566019 Length:598 Species:Rattus norvegicus


Alignment Length:246 Identity:49/246 - (19%)
Similarity:87/246 - (35%) Gaps:64/246 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 KILVKKLDLGSQKSVREFAADIVKTEPKIDVLIHNAGM--ALAFRGQTSEDGVELTMATNHYG-- 164
            ::..:|..:|:  |..|..|...:|..|:.|.|....:  ...||....:..:.|..::..:|  
  Rat   365 RVRPRKSQVGA--SASESQALGSRTHSKLQVSIPRFPLKRCATFRSSGPDPTLNLAQSSPSFGSN 427

  Fly   165 -PFL------LTHLLIDVLKKSAPARIVIVASELYRLSSVNLAKLNPIGTFPAAYLYYVSKFANI 222
             |||      |...|:.....|||:                 .||.|...:|:.:.....:...:
  Rat   428 LPFLSPGFRFLARNLVPPDVASAPS-----------------PKLWPRAKWPSGWEREAEQLGEL 475

  Fly   223 YFARELAKRLEGTKVTVNFLHPGMIDSGIWRNVPFPLNLPMM--AITKGFFKTTKAGAQTTIYLA 285
            :..|        |:|......|  ::..:..:..:||.:|.:  |.::..:|.          :.
  Rat   476 WAGR--------TRVPPQGQEP--VEDSVSEDSGWPLAVPQVLEATSQVLWKP----------MV 520

  Fly   286 TSNEVANVSG-KYFMDCKEATLNAAALDEEKGLKIWEESVKIVKLTPQDPK 335
            .|..:..|.| ..:....:..||.||:.||.     ||.      |||.|:
  Rat   521 ISENMKLVPGVSMWNRGTQELLNPAAIQEEA-----EEG------TPQAPE 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 45/236 (19%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 43/229 (19%)
LOC500227XP_038964083.1 DUF4639 8..571 CDD:406041 49/246 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.