DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and rdh13

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001011000.1 Gene:rdh13 / 496409 XenbaseID:XB-GENE-965068 Length:329 Species:Xenopus tropicalis


Alignment Length:317 Identity:131/317 - (41%)
Similarity:185/317 - (58%) Gaps:16/317 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 AAIVATLMSIRFYLR--ITAGRCFTETKMEGKTVIITGANSGIGKETAKDLAGRGARIIMACRNL 86
            |::|.|.:.....|:  ...|.|.::..:.|:|||:||||:|||||||.:||.||.|||||||::
 Frog     8 ASMVGTALGGAILLKDYTGGGNCPSKASIIGQTVIVTGANTGIGKETALELAKRGGRIIMACRDM 72

  Fly    87 -ETANAVKDEIVKETKNNKILVKKLDLGSQKSVREFAADIVKTEPKIDVLIHNAGMALAFRGQTS 150
             :..||.:| |..:|.|:.:..:.|||.|.||::|||..|:..|.::||||:||.:......:| 
 Frog    73 GKCENAARD-IRGKTLNHNVFARHLDLASSKSIKEFAKTIINEEERVDVLINNAAVMRCPHWKT- 135

  Fly   151 EDGVELTMATNHYGPFLLTHLLIDVLKKSAPARIVIVASELYRLSSVNLAKLN----PIGTFPAA 211
            ||..|:....||.|.||||:||::.:|:|..:||:.|:|..:....::...||    ...|..| 
 Frog   136 EDNFEMQFGVNHLGHFLLTNLLLEKMKRSENSRIINVSSLAHIAGDIDFDDLNWEKKKYNTKAA- 199

  Fly   212 YLYYVSKFANIYFARELAKRLEGTKVTVNFLHPGMIDSGIWRNVPFPLNLPMMAITKGFF----K 272
              |..||.||:.|..||||||:|||:|.|.||||:.|:.:.|:.....:.....|....|    |
 Frog   200 --YCQSKLANVLFTNELAKRLQGTKLTANSLHPGVADTELGRHTGMHQSAFSSTILAPLFWFLVK 262

  Fly   273 TTKAGAQTTIYLATSNEVANVSGKYFMDCKEATLNAAALDEEKGLKIWEESVKIVKL 329
            :.|..||.::|||.:..:..||||||...||......|||||...|:||||.|:|.|
 Frog   263 SPKQAAQPSVYLAVAENLQGVSGKYFNALKEKEPAPQALDEESARKLWEESAKLVHL 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 123/283 (43%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 118/276 (43%)
rdh13NP_001011000.1 retinol-DH_like_SDR_c 38..313 CDD:212495 120/279 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.