DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and naz

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster


Alignment Length:341 Identity:117/341 - (34%)
Similarity:177/341 - (51%) Gaps:37/341 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LMTSVAAIVATLMSIRFYLRITAGRCFTETKMEGKTVIITGANSGIGKETAKDLAGRGARIIMAC 83
            |...:...|.||||        ..||..:.:::.:.|::||.|||||.|.|:.|||||.|||:||
  Fly    24 LTVGIVITVRTLMS--------GQRCPNDNQIKEQIVVVTGGNSGIGFEIAQALAGRGGRIILAC 80

  Fly    84 RNLE----TANAVKDEIVKETKNNK------------ILVKKLDLGSQKSVREFAADIVKTEPKI 132
            ||||    .|..:|.|:...|..|.            :..:.|||.|.:||..||..::....:|
  Fly    81 RNLEAGKRAAAIIKRELGCRTPLNSLDEDDNPEDRYFVEARYLDLCSLRSVHHFAGQLMAEFERI 145

  Fly   133 DVLIHNAGMALAFRGQTSEDGVELTMATNHYGPFLLTHLLIDVLKKSAPARIVIVASELYRLSSV 197
            |||::|||:..|.....:|||.|.....|:..||||||||:..|::|...||:.|::..::.:.:
  Fly   146 DVLVNNAGVVFANTQMPTEDGFERHSQVNYLAPFLLTHLLLPHLQRSEQGRILFVSAHAHQGAKI 210

  Fly   198 NLAKLNPIGT----FPAAYLYYVSKFANIYFARELAKRLEGTKVTVNFLHPGMI-DSGIWRNVPF 257
            :......:||    |.|...:..||...:...|.:|:.|:||.||||...||:: .:..:||.|.
  Fly   211 DFDDPLNVGTWSVKFHAREAFAHSKLCVLLATRWMARELKGTSVTVNCCTPGLVRGTRHFRNSPL 275

  Fly   258 PLNLPMMAITKG----FFKTTKAGAQTTIYLATSNEVANVSGKYFMDCKEATLNAAALDEEKGLK 318
            ..:|.:.|:|..    |.|....|||..|.|||..::..|:|:||.||:.|..:....|:|...|
  Fly   276 MSSLCVKAVTYPWMWLFMKNAYEGAQCAIRLATDPQLKEVTGEYFNDCEIAASSVTGQDKELAKK 340

  Fly   319 IWEESVK----IVKLT 330
            ::.:::|    :.|||
  Fly   341 LYMQTIKTLESVTKLT 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 106/303 (35%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 105/292 (36%)
nazNP_001287387.1 FabG 47..318 CDD:223959 96/270 (36%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 105/291 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I1353
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24320
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
76.970

Return to query results.
Submit another query.