DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and wwox

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_957207.1 Gene:wwox / 393887 ZFINID:ZDB-GENE-040426-858 Length:412 Species:Danio rerio


Alignment Length:296 Identity:104/296 - (35%)
Similarity:163/296 - (55%) Gaps:12/296 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 MEGKTVIITGANSGIGKETAKDLAGRGARIIMACRNLETANAVKDEIVKETKNNKILVKKLDLGS 114
            :..|.:|:||||||||.|||:..|..||.:|:||||...|:.....|:.|....::.|..|||.|
Zfish   119 LSDKVIIVTGANSGIGFETARSFALHGAHVILACRNQSRASKAASLIMGEWSKARVEVLPLDLAS 183

  Fly   115 QKSVREFAADIVKTEPKIDVLIHNAGMALAFRGQTSEDGVELTMATNHYGPFLLTHLLIDVLKKS 179
            .:|||:||.....|:..:.||:.||.:. :...:.:|||.|.|....|.|.|||..||.|||:.|
Zfish   184 LRSVRQFAELFKATKLPLHVLVCNAAVC-SQPWRLTEDGFESTFQICHLGHFLLVQLLQDVLRLS 247

  Fly   180 APARIVIVASELYRLS-------SVNLAKLN-PIGTFPAAYLYYVSKFANIYFARELAKRLEGTK 236
            ||||:|:|:||.:|.:       :::|..|: |...:.:...|..:|..|:.|:.||.:|:....
Zfish   248 APARVVVVSSESHRFTDLLDSCGNLDLDLLSPPQKNYWSLLAYNRAKLCNLLFSSELHRRMSPHG 312

  Fly   237 VTVNFLHPG-MIDSGIWRNVPFPLNLPMMAITKGFFKTTKAGAQTTIYLATSNEVANVSGKYFMD 300
            :..|.|||| |:.:.|.|:  :.|...:.::.:.|.|:.:.||.||:|.|.:.|:..:.|.||.:
Zfish   313 ICCNALHPGSMMFTSIHRS--WWLLTLLFSLARPFTKSMQQGAATTVYCAVAPELEGIGGMYFNN 375

  Fly   301 CKEATLNAAALDEEKGLKIWEESVKIVKLTPQDPKI 336
            |.....:..|.|....|.:||.|.::|:.....|::
Zfish   376 CFRCLPSPQAQDPAAALSLWELSERLVQERSTPPQV 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 102/283 (36%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 99/276 (36%)
wwoxNP_957207.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
WW 18..47 CDD:278809
Nuclear localization signal. /evidence=ECO:0000250 50..55
WW 59..88 CDD:278809
PRK06196 108..402 CDD:235736 102/285 (36%)
human_WWOX_like_SDR_c-like 121..404 CDD:187669 103/285 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.