DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and C2orf81

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001303693.1 Gene:C2orf81 / 388963 HGNCID:34350 Length:615 Species:Homo sapiens


Alignment Length:172 Identity:34/172 - (19%)
Similarity:50/172 - (29%) Gaps:77/172 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 FLLTH-LLIDVLKKSAPARIVIVASELYRLSSVNLAKLNPIGTFPAAYLYYVSKFANIYFAR--- 226
            ||.|| :|.||.:..:|                   ||.|...:|:.:.........::..|   
Human   479 FLTTHPVLPDVARSRSP-------------------KLWPSVRWPSGWEGKAELLGELWAGRTRV 524

  Fly   227 -----ELAKRLEGTKVTVNFLHPGMIDSGIW-RNVPFPLNLPMMAITKGFFKTTKAGAQTTIYLA 285
                 |||.| ||.            |.|.| |..|     |::..|                  
Human   525 PPQGLELADR-EGQ------------DPGRWPRTTP-----PVLEAT------------------ 553

  Fly   286 TSNEVANVSGKYFMDCKEATLNAAALDEEKGLKIWEESVKIV 327
                 :.|..|       ..|...||....|:.:|..|.:::
Human   554 -----SQVMWK-------PVLLPEALKLAPGVSMWNRSTQVL 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 34/170 (20%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 32/163 (20%)
C2orf81NP_001303693.1 DUF4639 9..614 CDD:292118 34/172 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.