DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and CG11200

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster


Alignment Length:295 Identity:89/295 - (30%)
Similarity:143/295 - (48%) Gaps:25/295 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 KMEGKTVIITGANSGIGKETAKDLAGRGARIIMACRNLETANAVKDEIV--KETKNNKILVKKLD 111
            |...:..:|||.|.|||....:.|......::|..|:.:.|......||  ..|| .|::.::||
  Fly    64 KQPDRIAVITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASIVDLNATK-GKLICEQLD 127

  Fly   112 LGSQKSVREFAADIVKTEPKIDVLIHNAGMALA-FRGQTSEDGVELTMATNHYGPFLLTHLLIDV 175
            :|..|||:.||..|.:...|:|:|::|||:..| |:  .:.||.|...|.|..|.|||||||:..
  Fly   128 VGDLKSVKAFAQLIKERYSKVDLLLNNAGIMFAPFK--LTADGYESHFAINFLGHFLLTHLLLPQ 190

  Fly   176 L----KKSAPARIVIVASELYRLSSVNLAKLNPIGTFPAAYLYYVSKFANIYFARELAKRLEGTK 236
            |    |:...:|||.|:|.:..:..:|...:|....:.....|..||.|.|.|.|.|...|:..|
  Fly   191 LRAAGKEGRNSRIVNVSSCVNLIGRINYKDINGTKHYYPGTAYSQSKLAQILFTRHLQTLLDAEK 255

  Fly   237 --VTVNFLHPGMIDSGIWR-----NVPFPLNLPMMAITKGFFKTTKAGAQTTIYLATSNEVANVS 294
              |.||.:|||::|:.::.     :||.        ..|.||||.:.|::|.::.|....:....
  Fly   256 SHVQVNVVHPGIVDTDLFEHSATTSVPI--------FKKLFFKTPERGSRTVVFAAIDPSIEGQG 312

  Fly   295 GKYFMDCKEATLNAAALDEEKGLKIWEESVKIVKL 329
            |.|..:..:...:..|....|..::::.|..::|:
  Fly   313 GTYLSNGGKGPFHPDAKKPAKCEQLFQFSCDLLKI 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 87/288 (30%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 86/281 (31%)
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 88/290 (30%)
NADB_Rossmann 67..338 CDD:304358 86/281 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I1484
eggNOG 1 0.900 - - E2759_KOG1208
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I1353
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - otm46796
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24320
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.