DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and Rdh11

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001012193.1 Gene:Rdh11 / 362757 RGDID:1312001 Length:316 Species:Rattus norvegicus


Alignment Length:323 Identity:120/323 - (37%)
Similarity:185/323 - (57%) Gaps:33/323 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LMSIRFYL---------RITAGRCFTETKMEGKTVIITGANSGIGKETAKDLAGRGARIIMACRN 85
            |:|:.|.|         .::.|.|.:..::.||..|:||||:|||||||||||.||||:.:|||:
  Rat     7 LLSLPFILFLVTPKIRKMLSCGVCTSNVQLSGKVAIVTGANTGIGKETAKDLARRGARVYLACRD 71

  Fly    86 LETANAVKDEIVKETKNNKILVKKLDLGSQKSVREFAADIVKTEPKIDVLIHNAGMALAFRGQTS 150
            ::....|..||...|.|:::||:||||...||:|.||...:..|..:.:||:|||:.:....:|:
  Rat    72 MQKGELVASEIQATTGNSQVLVRKLDLADTKSIRAFAEGFLAEEKYLHILINNAGVMMCPYSKTA 136

  Fly   151 EDGVELTMATNHYGPFLLTHLLIDVLKKSAPARIVIVASELYRLSSVNLAKLNPIGTFPAAYLYY 215
             ||.|:....||.|.|||||||::.||:|.|:|:|.|:|..:.|..::...|:....:.....|.
  Rat   137 -DGFEMHFGVNHLGHFLLTHLLLEKLKESGPSRVVNVSSLAHHLGRIHFHNLHGEKFYSGGLAYC 200

  Fly   216 VSKFANIYFARELAKRLEGTKVTVNFLHPGMIDS----------GIWRNVPFPLNLPMMAITKGF 270
            .||.|||.|.:|||:||:|::||...:|||.:.|          .:|:...|            |
  Rat   201 HSKLANILFTKELARRLKGSRVTTYSVHPGTVHSELIRHSTALKWLWQLFFF------------F 253

  Fly   271 FKTTKAGAQTTIYLATSNEVANVSGKYFMDCKEATLNAAALDEEKGLKIWEESVKIVKLTPQD 333
            .||.:.||||::|.|.:..:..:||.:|.||:.|.:::.|.:|....::|:.|..::.| |.|
  Rat   254 IKTPQQGAQTSLYCAVTEGIEGLSGSHFSDCQLAWVSSQAGNETIARRLWDVSCDLLGL-PMD 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 111/284 (39%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 109/277 (39%)
Rdh11NP_001012193.1 NADB_Rossmann 38..306 CDD:419666 110/280 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D1032903at2759
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.