DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and F32A5.8

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_495516.2 Gene:F32A5.8 / 353400 WormBaseID:WBGene00017971 Length:257 Species:Caenorhabditis elegans


Alignment Length:230 Identity:76/230 - (33%)
Similarity:110/230 - (47%) Gaps:16/230 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 FYLRITAGRCFTETKMEGKTVIITGANSGIGKETAKDLAGRGARIIMACRNLETANAVKDEIVKE 99
            |:.|..|.....|..:.|||..|||..||||.|||:.||.:||.::|..||:..:..:|..|.:|
 Worm    19 FHSRTNALDTLKEIDLSGKTYAITGTTSGIGIETARALALKGAHVVMFNRNIVESEKLKKRIEEE 83

  Fly   100 TKNNKILVKKLDLGSQKSVREFAADIVKTEPKIDVLIHNAGMALAFRGQTSEDGVELTMATNHYG 164
            ..:.||.....||.|.:|.:..|.:.:.....:..||.|||: .|...:.:.|..|.....||..
 Worm    84 KPDVKIDFISCDLNSLQSAKAAADEFLSKHWPLHGLILNAGV-FAPTVKFTFDNFESHFGVNHLA 147

  Fly   165 PFLLTHLLIDVLKKSAPARIVIVAS----------ELYRLSSVNLAKLNPIGTFPAAY-LYYVSK 218
            .|||...|:..|::|:|||||.|:|          |:.|...:|  ||.|.......| ||..||
 Worm   148 QFLLAKELLPALRQSSPARIVFVSSVSSSHTGLKAEMTRSEKLN--KLCPENANEFYYKLYAYSK 210

  Fly   219 FANIYFARELAK-RLEGTKVTVNFLHPG-MIDSGI 251
            ...:..|.::.: ......::...:||| ||.:||
 Worm   211 MCQVLTAFKIHRDEFVSHGISTYAIHPGTMIGTGI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 72/213 (34%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 72/213 (34%)
F32A5.8NP_495516.2 NADB_Rossmann 36..>245 CDD:304358 70/211 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1032903at2759
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.