DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and CG3699

DIOPT Version :10

Sequence 1:NP_650717.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster


Alignment Length:211 Identity:65/211 - (30%)
Similarity:98/211 - (46%) Gaps:28/211 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 MEGKTVIITGANSGIGKETAKDLAGRGARIIMACRNLETANAVKDEIVKETKNNKI---LVKKLD 111
            :..|.||:|||:||||...|:.||..||.:.:..||:....|.|..: |.|:...:   :.|..|
  Fly     3 LSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSL-KGTQAEIVVADVTKDAD 66

  Fly   112 LGSQKSVREFAADIVKTEPKIDVLIHNAGMALAFRGQTSEDGVEL--TMATNHYGPFLLTHLLID 174
            ...|:::.:|.        :||||::|||: |...|....|..|.  .:.||..|..|||..::.
  Fly    67 AIVQQTLAKFG--------RIDVLVNNAGI-LGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVLP 122

  Fly   175 VLKKSAPARIVIVASELYRLSSVNLAKLNPIGTFPAAYLYYVSKFANIYFARELAKRLEGTKVTV 239
            .|.|:..|             .||::....|..|..|..|.|||.|...|.:.:|..:....|.|
  Fly   123 HLLKTKGA-------------VVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRV 174

  Fly   240 NFLHPGMIDSGIWRNV 255
            |.::||.:.:.|.||:
  Fly   175 NSVNPGFVVTNIHRNI 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_650717.1 retinol-DH_like_SDR_c_like 52..320 CDD:212492 65/209 (31%)
CG3699NP_569875.2 Rossmann-fold NAD(P)(+)-binding proteins 3..248 CDD:473865 65/211 (31%)

Return to query results.
Submit another query.