DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and Cbr3

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001100580.1 Gene:Cbr3 / 304078 RGDID:1309728 Length:277 Species:Rattus norvegicus


Alignment Length:269 Identity:62/269 - (23%)
Similarity:115/269 - (42%) Gaps:55/269 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 KTVIITGANSGIGKETAKDLAGR-GARIIMACRNLETANAVKDEIVKETKNNKILVKKLDLGSQK 116
            :..::||||.|||....:||..: ...:::..|:.....|...::..|..:.:.  .:||:.:.:
  Rat     6 RVALVTGANKGIGFAITRDLCRKFSGDVVLTARDEARGRAAVKQLQAEGLSPRF--HQLDIDNPQ 68

  Fly   117 SVREFAADIVKTEPKIDVLIHNAGMALAFRGQTSED-GVELTMATNHYGPFLLTHLLIDVLKKSA 180
            |:|.....:.|....::||::|||:|......|..| ..|:|:.||.:....:...|:.::|.. 
  Rat    69 SIRALRDFLRKEYGGLNVLVNNAGIAFRMDDPTPFDVQAEVTLKTNFFATRNVCTELLPIMKPH- 132

  Fly   181 PARIVIVAS---------------ELYRLSS------VNLAK---------LNPIGTFPAAYLYY 215
             .|:|.|:|               |.:|..:      |:|.|         ::....:|.: .|.
  Rat   133 -GRVVNVSSLQGLKALENCSEDLQERFRCDTLTEGDLVDLMKKFVEDTKNEVHEREGWPDS-AYG 195

  Fly   216 VSKFANIYFARELAKRLE----GTKVTVNFLHPGMIDSGIWRNVPFPLNLPMMAITKGFFKTTKA 276
            |||.......|.||::|:    ..::.:|...||.:.:.             ||..:| .:|.:.
  Rat   196 VSKLGVTVLTRILARQLDEKRKADRILLNACCPGWVKTD-------------MARDQG-SRTVEE 246

  Fly   277 GAQTTIYLA 285
            ||:|.:|||
  Rat   247 GAETPVYLA 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 62/269 (23%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 62/269 (23%)
Cbr3NP_001100580.1 carb_red_PTCR-like_SDR_c 6..277 CDD:187585 62/269 (23%)
adh_short 6..241 CDD:278532 55/253 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.