DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and Dhrs13

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_038943561.1 Gene:Dhrs13 / 303275 RGDID:1305508 Length:375 Species:Rattus norvegicus


Alignment Length:305 Identity:118/305 - (38%)
Similarity:185/305 - (60%) Gaps:12/305 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 FYLRITAGRCFTETKMEGKTVIITGANSGIGKETAKDLAGRGARIIMACRNLETANAVKDEIVKE 99
            :|..:.|..|.....:.|:|.::|||||||||.||.:||.||||:::|||:.|...|...::.:|
  Rat    19 YYNLVKAPPCGGIGSLRGRTAVVTGANSGIGKMTALELARRGARVVLACRSRERGEAAAFDLRQE 83

  Fly   100 TKNNKILVKKLDLGSQKSVREFAADIVKTEPKIDVLIHNAGMALAFRGQTSEDGVELTMATNHYG 164
            :.||:::...|||.|..||:.||...:.:||::|:||||||::..  |:|.|. ..|.:..||.|
  Rat    84 SGNNEVIFMALDLASLTSVQAFATAFLSSEPRLDILIHNAGISSC--GRTRET-FNLLLRVNHVG 145

  Fly   165 PFLLTHLLIDVLKKSAPARIVIVASELYRLSSVNLAKLN--PIGTFPAAYLYYVSKFANIYFARE 227
            ||||||||:..|:..||:|:|||:|..:|...::..:|:  .:|.......|..||.||:.||||
  Rat   146 PFLLTHLLLPRLRSCAPSRVVIVSSAAHRRGRLDFTRLDCPVVGWQQELRAYADSKLANVLFARE 210

  Fly   228 LAKRLEGTKVTVNFLHPGMIDSGIW-RNVP---FPLNLPMMAITKGFFKTTKAGAQTTIYLATSN 288
            ||.:||||.||....|||.::|.:: |::|   .|:..|:..:.   .:..:.||||.:|.|...
  Rat   211 LATQLEGTGVTCYAAHPGPVNSELFLRHLPGWLRPILRPLAWLV---LRAPQGGAQTPLYCALQE 272

  Fly   289 EVANVSGKYFMDCKEATLNAAALDEEKGLKIWEESVKIVKLTPQD 333
            .:..:||:||.:|....::|||.|::...::|:.:.|:..|.|:|
  Rat   273 GIEPLSGRYFANCHVEEVSAAARDDQAAHRLWKVTKKLAGLGPED 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 112/280 (40%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 110/273 (40%)
Dhrs13XP_038943561.1 retinol-DH_like_SDR_c_like 36..304 CDD:212492 110/273 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.