DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and Dhrsx

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_006249055.1 Gene:Dhrsx / 288525 RGDID:1305017 Length:331 Species:Rattus norvegicus


Alignment Length:312 Identity:94/312 - (30%)
Similarity:148/312 - (47%) Gaps:9/312 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VAAIVATLMSIRFYLRITAGRCFTETKMEG-KTVIITGANSGIGKETAKDLAGRGARIIMACRNL 86
            |.|:...:..::...|:..|....|..::. :..|:|||..|:|..||..||..|.|:|:|..:.
  Rat    11 VYAVGVAVTMVQLLRRLRGGFRPPELPLQADRVAIVTGATRGVGLSTACQLARLGMRVIVAGNDE 75

  Fly    87 ETANAVKDEIVKETKNNKILVKKLDLGSQKSVREFAADIVKTEPKIDVLIHNAGMALAFRGQTSE 151
            ...:.|...|.:|:.........|||.|..|||.|..:...|...:.:||:|||:.|...|.| :
  Rat    76 HRGHEVVARIQEESGPESAHFLFLDLASLSSVRSFVRNFEATALPLHLLINNAGVMLDPSGNT-K 139

  Fly   152 DGVELTMATNHYGPFLLTHLLIDVLKKSA----PARIVIVASELYRLSSVNLAKLNPIGTFPAAY 212
            ||.|..:..|..|.||||.||:..|:.|.    .:|::.|.|..:.:...::|:|......|.|.
  Rat   140 DGFERHVGVNFLGHFLLTSLLLPALRASGHQGRKSRVITVCSSTHWVGQADVARLLGQSPAPCAL 204

  Fly   213 LYYV-SKFANIYFARELAKRLE--GTKVTVNFLHPGMIDSGIWRNVPFPLNLPMMAITKGFFKTT 274
            ..|. ||.|...|:..|.:.|.  |..||.|.:.||::|:.::.:..:........:....|||.
  Rat   205 AAYAGSKLALALFSLRLQRLLSALGDPVTANIVDPGVVDTALFAHAGWGTRAVQRFLGWLLFKTP 269

  Fly   275 KAGAQTTIYLATSNEVANVSGKYFMDCKEATLNAAALDEEKGLKIWEESVKI 326
            ..||.|::|.|.|.::..:.|:|..|..||.:..||.|.|....:|.||.::
  Rat   270 DEGAWTSVYAAASPKLEGIGGRYLRDEAEAEVLGAARDLELQGHLWAESCRL 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 89/283 (31%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 86/275 (31%)
DhrsxXP_006249055.1 PRK06197 36..326 CDD:235737 89/287 (31%)
NADB_Rossmann 41..315 CDD:304358 86/274 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.