DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and CG30495

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster


Alignment Length:331 Identity:132/331 - (39%)
Similarity:188/331 - (56%) Gaps:27/331 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VRDIFLMTSVAAIVATLMSIRFYLRITAGRCFTETKMEGKTVIITGANSGIGKETAKDLAGRGAR 78
            :..:||...:..|:|  ..:|.|::  .|:...:|...||..|:||.|:|:||||..:||.|||.
  Fly    11 IAPVFLAHGIVGIIA--FCVRLYMQ--GGKFRKQTDETGKVAIVTGGNTGLGKETVMELARRGAT 71

  Fly    79 IIMACRNLETANAVKDEIVKETKNNKILVKKLDLGSQKSVREFAADIVKTEPKIDVLIHNAGMAL 143
            :.|||||.|.....:.||||||.|:.:..::.||.|..|:|:||.:..|.:..:.:||:|||:..
  Fly    72 VYMACRNKEKVERARREIVKETGNSNVFSRECDLSSLDSIRKFAENFKKEQRVLHILINNAGVFW 136

  Fly   144 AFRGQTSEDGVELTMATNHYGPFLLTHLLIDVLKKSAPARIVIVASELYRLSSVNLAKLNPIGTF 208
            .....|.| |.|:.:..||.|.||||:||:.||::|||:|:|:|||..:....:.:..:|....:
  Fly   137 EPHRLTKE-GFEMHLGVNHIGHFLLTNLLLGVLERSAPSRVVVVASRAHERGQIKVDDINSSDFY 200

  Fly   209 PAAYLYYVSKFANIYFARELAKRLEGTKVTVNFLHPGMIDSGIWRNVPF---------------P 258
            .....|..||.|||.|.||||||||||.||||.|:||:.|:.|.||:.|               |
  Fly   201 DEGVAYCQSKLANILFTRELAKRLEGTGVTVNALNPGIADTEIARNMIFFQTKFAQYVVETILRP 265

  Fly   259 LNLPMMAITKGFFKTTKAGAQTTIYLATSNEVANVSGKYFMDCKEATLNAAALDEEKGLKIWEES 323
            |...:|       ||.|.|||||:|.|...::..|||:||.||..|.:..||||::....:|.:|
  Fly   266 LLWAVM-------KTPKNGAQTTLYAALDPDLERVSGQYFSDCALAPVAPAALDDQMAQWLWAQS 323

  Fly   324 VKIVKL 329
            .|..|:
  Fly   324 EKWAKI 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 123/289 (43%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 120/282 (43%)
CG30495NP_001260785.1 FabG 44..296 CDD:223959 110/259 (42%)
NADB_Rossmann 45..323 CDD:304358 121/285 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 171 1.000 Domainoid score I1148
eggNOG 1 0.900 - - E2759_KOG1208
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 184 1.000 Inparanoid score I1096
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - mtm1091
orthoMCL 1 0.900 - - OOG6_100091
Panther 1 1.100 - - P PTHR24320
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
109.870

Return to query results.
Submit another query.