DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and DHRSX

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_660160.2 Gene:DHRSX / 207063 HGNCID:18399 Length:330 Species:Homo sapiens


Alignment Length:280 Identity:90/280 - (32%)
Similarity:145/280 - (51%) Gaps:7/280 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 KTVIITGANSGIGKETAKDLAGRGARIIMACRNLETANAVKDEIVKETKNNKILVKKLDLGSQKS 117
            :..|:||...|||..|||.||..|..:|:|..|...|..|..:|.:||.|:|:.....||.|..|
Human    44 RVAIVTGGTDGIGYSTAKHLARLGMHVIIAGNNDSKAKQVVSKIKEETLNDKVEFLYCDLASMTS 108

  Fly   118 VREFAADIVKTEPKIDVLIHNAGMALAFRGQTSEDGVELTMATNHYGPFLLTHLLIDVLKKSA-- 180
            :|:|.......:..:.|||:|||:.:..:.:| .||.|.....|:.|.||||:||:|.||:|.  
Human   109 IRQFVQKFKMKKIPLHVLINNAGVMMVPQRKT-RDGFEEHFGLNYLGHFLLTNLLLDTLKESGSP 172

  Fly   181 --PARIVIVASELYRLSSVNLAKLNPIGTFPAAYLYYVSKFANIYFARELAKRL--EGTKVTVNF 241
              .||:|.|:|..:.::.:|:..|.....:.....|..||.|.:.|...|.:.|  ||:.||.|.
Human   173 GHSARVVTVSSATHYVAELNMDDLQSSACYSPHAAYAQSKLALVLFTYHLQRLLAAEGSHVTANV 237

  Fly   242 LHPGMIDSGIWRNVPFPLNLPMMAITKGFFKTTKAGAQTTIYLATSNEVANVSGKYFMDCKEATL 306
            :.||::::.::::|.:...|....:....|||...||.|:||.|.:.|:..|.|.|..:.||...
Human   238 VDPGVVNTDVYKHVFWATRLAKKLLGWLLFKTPDEGAWTSIYAAVTPELEGVGGHYLYNEKETKS 302

  Fly   307 NAAALDEEKGLKIWEESVKI 326
            .....:::...::|.:|.::
Human   303 LHVTYNQKLQQQLWSKSCEM 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 90/280 (32%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 88/272 (32%)
DHRSXNP_660160.2 PRK06197 39..325 CDD:235737 90/280 (32%)
retinol-DH_like_SDR_c_like 43..316 CDD:212492 88/272 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.