DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and DHRS13

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_653284.2 Gene:DHRS13 / 147015 HGNCID:28326 Length:377 Species:Homo sapiens


Alignment Length:314 Identity:120/314 - (38%)
Similarity:182/314 - (57%) Gaps:19/314 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 FYLRITAGRCFTETKMEGKTVIITGANSGIGKETAKDLAGRGARIIMACRNLETANAVKDEIVKE 99
            :|..:.|..|.....:.|:|.::|||||||||.||.:||.||||:::|||:.|...|...::.:|
Human    19 YYNLVKAPPCGGMGNLRGRTAVVTGANSGIGKMTALELARRGARVVLACRSQERGEAAAFDLRQE 83

  Fly   100 TKNNKILVKKLDLGSQKSVREFAADIVKTEPKIDVLIHNAGMALAFRGQTSEDGVELTMATNHYG 164
            :.||:::...|||.|..|||.||...:.:||::|:||||||::..  |:|.| ...|.:..||.|
Human    84 SGNNEVIFMALDLASLASVRAFATAFLSSEPRLDILIHNAGISSC--GRTRE-AFNLLLRVNHIG 145

  Fly   165 PFLLTHLLIDVLKKSAPARIVIVASELYRLSSVNLAKLN--PIGTFPAAYLYYVSKFANIYFARE 227
            ||||||||:..||..||:|:|:|||..:....::..:|:  .:|.......|..:|.||:.||||
Human   146 PFLLTHLLLPCLKACAPSRVVVVASAAHCRGRLDFKRLDRPVVGWRQELRAYADTKLANVLFARE 210

  Fly   228 LAKRLEGTKVTVNFLHPGMIDSGIW-RNVP---FPLNLPMMAITKGFFKTTKAGAQTTIYLATSN 288
            ||.:||.|.||....|||.::|.:: |:||   .||..|:..:.   .:..:.||||.:|.|...
Human   211 LANQLEATGVTCYAAHPGPVNSELFLRHVPGWLRPLLRPLAWLV---LRAPRGGAQTPLYCALQE 272

  Fly   289 EVANVSGKYFMDCKEATLNAAALDEEKGLKIWEESVKIVKLTP-------QDPK 335
            .:..:||:||.:|....:..||.|:....::||.|.::..|.|       :||:
Human   273 GIEPLSGRYFANCHVEEVPPAARDDRAAHRLWEASKRLAGLGPGEDAEPDEDPQ 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 113/280 (40%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 110/273 (40%)
DHRS13NP_653284.2 retinol-DH_like_SDR_c_like 36..304 CDD:212492 110/273 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 309..377 4/18 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.690

Return to query results.
Submit another query.