DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and Cbr1

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_031646.2 Gene:Cbr1 / 12408 MGIID:88284 Length:277 Species:Mus musculus


Alignment Length:291 Identity:69/291 - (23%)
Similarity:120/291 - (41%) Gaps:70/291 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 IITGANSGIGKETAKDLAGR-GARIIMACRNLETANAVKDEIVKETKNNKILVKKLDLGSQKSVR 119
            ::||||.|||....:||..: ...:::|.|:.|.......::..|..:.:.  .:||:.:.:|:|
Mouse     9 LVTGANKGIGFAITRDLCRKFSGDVVLAARDEERGQTAVQKLQAEGLSPRF--HQLDIDNPQSIR 71

  Fly   120 EFAADIVKTEPKIDVLIHNAGMALAFRGQTS-EDGVELTMATNHYGPFLLTHLLIDVLKKSAP-- 181
            .....::|....:|||::|||:|......|. ....|:||.||.:|       ..||.|:..|  
Mouse    72 ALRDFLLKEYGGLDVLVNNAGIAFKVNDDTPFHIQAEVTMKTNFFG-------TRDVCKELLPLI 129

  Fly   182 ---ARIVIVAS---------------ELYRLSSVNLAKLNPIGT-----------------FPAA 211
               .|:|.|:|               :.:|..::...:|  :|.                 :|.:
Mouse   130 KPQGRVVNVSSMVSLRALKNCRLELQQKFRSETITEEEL--VGLMNKFVEDTKKGVHAEEGWPNS 192

  Fly   212 YLYYVSKFANIYFARELAKRL----EGTKVTVNFLHPGMIDSGIWRNVPFPLNLPMMAITKGFFK 272
             .|.|:|......:|.||::|    .|.|:.:|...||.:.:.             ||..|. .|
Mouse   193 -AYGVTKIGVTVLSRILARKLNEQRRGDKILLNACCPGWVRTD-------------MAGPKA-TK 242

  Fly   273 TTKAGAQTTIYLA-TSNEVANVSGKYFMDCK 302
            :.:.||:|.:||| ...:.....|::..|.|
Mouse   243 SPEEGAETPVYLALLPPDAEGPHGQFVQDKK 273

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 69/291 (24%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 69/291 (24%)
Cbr1NP_031646.2 carb_red_PTCR-like_SDR_c 7..277 CDD:187585 69/291 (24%)
adh_short 7..239 CDD:278532 58/254 (23%)
Glutathione binding. /evidence=ECO:0000250|UniProtKB:P16152 95..97 0/1 (0%)