DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and RDH13

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001139443.1 Gene:RDH13 / 112724 HGNCID:19978 Length:331 Species:Homo sapiens


Alignment Length:329 Identity:125/329 - (37%)
Similarity:190/329 - (57%) Gaps:26/329 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 RDIFLMTSVAAIVATLMSIRFYLRITAGRCFTETKMEGKTVIITGANSGIGKETAKDLAGRGARI 79
            |.:..::::..:....:.::.|  :|.|.|.::..:.|||||:||||:||||:||.:||.||..|
Human     3 RYLLPLSALGTVAGAAVLLKDY--VTGGACPSKATIPGKTVIVTGANTGIGKQTALELARRGGNI 65

  Fly    80 IMACRNLETANAVKDEIVKETKNNKILVKKLDLGSQKSVREFAADIVKTEPKIDVLIHNAGMALA 144
            |:|||::|...|...:|..||.|:.:..:.|||.|.||:|||||.|::.|.::|:||:|||: :.
Human    66 ILACRDMEKCEAAAKDIRGETLNHHVNARHLDLASLKSIREFAAKIIEEEERVDILINNAGV-MR 129

  Fly   145 FRGQTSEDGVELTMATNHYGPFLLTHLLIDVLKKSAPARIVIVASELYRLSSVNLAKLN-PIGTF 208
            ....|:|||.|:....||.|.||||:||:|.||.|||:||:.::|..:....::...|| ....:
Human   130 CPHWTTEDGFEMQFGVNHLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFDDLNWQTRKY 194

  Fly   209 PAAYLYYVSKFANIYFARELAKRLEGTKVTVNFLHPGMIDSGIWRNVPFPLNLPMMAITKGFFKT 273
            .....|..||.|.:.|.:||::||:|:.||||.||||:..:.:.|:.         .|....|.:
Human   195 NTKAAYCQSKLAIVLFTKELSRRLQGSGVTVNALHPGVARTELGRHT---------GIHGSTFSS 250

  Fly   274 TKAG-------------AQTTIYLATSNEVANVSGKYFMDCKEATLNAAALDEEKGLKIWEESVK 325
            |..|             ||.:.|||.:.|:|:||||||...|:......|.|||...::|.||.:
Human   251 TTLGPIFWLLVKSPELAAQPSTYLAVAEELADVSGKYFDGLKQKAPAPEAEDEEVARRLWAESAR 315

  Fly   326 IVKL 329
            :|.|
Human   316 LVGL 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 118/288 (41%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 115/281 (41%)
RDH13NP_001139443.1 retinol-DH_like_SDR_c 38..313 CDD:212495 116/284 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.