DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and Rdh14

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_076186.1 Gene:Rdh14 / 105014 MGIID:1920402 Length:334 Species:Mus musculus


Alignment Length:334 Identity:141/334 - (42%)
Similarity:204/334 - (61%) Gaps:33/334 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SVAAIVATLMSIRFYLRITAGRCFTETK------------MEGKTVIITGANSGIGKETAKDLAG 74
            :||::.|.|::........|.|.|:..:            |.||||:|||||||:|:.||.:|..
Mouse     2 AVASVAAALLAALGGALWLAARRFSGPRNQRQQGGGDPGLMHGKTVLITGANSGLGRATAAELLR 66

  Fly    75 RGARIIMACRNL----ETANAVKDEIVK------ETKNNKILVKKLDLGSQKSVREFAADIVKTE 129
            .|||:||.||:.    |.|..::.|:.:      :..:.:::||:|||.|.:|||.|..::::.|
Mouse    67 LGARVIMGCRDRARAEEAAGQLRQELCQAGGAGPDGTDGQLVVKELDLASLRSVRAFCQELLQEE 131

  Fly   130 PKIDVLIHNAGMALAFRGQTSEDGVELTMATNHYGPFLLTHLLIDVLKKSAPARIVIVASELYRL 194
            |::||||:|||:......:| |||.|:....||.|.||||:||:.:||.|||:|||:|:|:||:.
Mouse   132 PRLDVLINNAGVFHCPYTKT-EDGFEMQFGVNHLGHFLLTNLLLGLLKSSAPSRIVVVSSKLYKY 195

  Fly   195 SSVNLAKLNPIGTFPAAYLYYVSKFANIYFARELAKRLEGTKVTVNFLHPGMIDSGIWRNVPFPL 259
            ..:|...||...::..::.|..||.|||.|.||||:|||||.||||.||||::.:.:.|::..||
Mouse   196 GEINFEDLNSEQSYNKSFCYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPL 260

  Fly   260 ------NLPMMAITKGFFKTTKAGAQTTIYLATSNEVANVSGKYFMDCKEATLNAAALDEEKGLK 318
                  ||    ::..||||...||||:||||.|.:|..|||:||.||||..|...|:||....|
Mouse   261 LARPLFNL----VSWAFFKTPLEGAQTSIYLACSPDVEGVSGRYFGDCKEEELLPKAMDESVARK 321

  Fly   319 IWEESVKIV 327
            :|:.|..:|
Mouse   322 LWDISEVMV 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 132/290 (46%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 130/283 (46%)
Rdh14NP_076186.1 PRK06197 43..332 CDD:235737 133/293 (45%)
NADB_Rossmann 44..326 CDD:304358 131/286 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 1 1.100 - - O PTHR24320
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.