DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and dhrsx

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_002933664.3 Gene:dhrsx / 100487450 XenbaseID:XB-GENE-5952439 Length:327 Species:Xenopus tropicalis


Alignment Length:282 Identity:92/282 - (32%)
Similarity:145/282 - (51%) Gaps:7/282 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GKTVIITGANSGIGKETAKDLAGRGARIIMACRNLETANAVKDEIVKETKNNKILVKKLDLGSQK 116
            ||..|:||...|||..|||.|:..|..:|:|..|....:.....|.::|.|.|:.....||.|.|
 Frog    41 GKVAIVTGGAKGIGYSTAKHLSSLGMHVIIAGNNEAEGSEAVTRIQQDTHNEKVEFLYCDLASMK 105

  Fly   117 SVREFAADIVKTEPKIDVLIHNAGMALAFRGQTSEDGVELTMATNHYGPFLLTHLLIDVLKKSAP 181
            |:|:|..........:.||::|||:.|....:|: ||.|.....|:.|.||||:||:...|:|..
 Frog   106 SIRQFVQIFKAKNLCLHVLVNNAGVMLVPERKTA-DGFEEHFGLNYLGHFLLTNLLLKTTKESGT 169

  Fly   182 ----ARIVIVASELYRLSSVNLAKLNPIGTFPAAYLYYVSKFANIYFARELAKRL--EGTKVTVN 240
                |||:.|:|..:.:..:|...||....:.....|..||.|.:.|...|.::|  :|..||.|
 Frog   170 ENLNARIITVSSATHYVGELNFDDLNSSCCYSPHGAYAQSKLALVMFTYYLQRQLSEDGCYVTAN 234

  Fly   241 FLHPGMIDSGIWRNVPFPLNLPMMAITKGFFKTTKAGAQTTIYLATSNEVANVSGKYFMDCKEAT 305
            .:.||::::.::|||.:|..|......:.||||.:.||.|:||.:.:.|:..:.|.|..:.::..
 Frog   235 VVDPGVVNTDLYRNVCWPGRLVKWMAARLFFKTAEEGAATSIYASVAPELEGIGGCYLYNGQKTK 299

  Fly   306 LNAAALDEEKGLKIWEESVKIV 327
            ....:.:|:...|:|.||.|:|
 Frog   300 SADISYNEDLQRKLWNESCKMV 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 91/280 (33%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 87/273 (32%)
dhrsxXP_002933664.3 retinol-DH_like_SDR_c_like 41..314 CDD:212492 87/273 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.