DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and dhrs12lb

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_002660947.2 Gene:dhrs12lb / 100334077 ZFINID:ZDB-GENE-131121-6 Length:345 Species:Danio rerio


Alignment Length:287 Identity:90/287 - (31%)
Similarity:140/287 - (48%) Gaps:30/287 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LMSIRFYLRI---TAGRCFT----ETKMEGKTVIITGANSGIGKETAKDLAGRGARIIMACRNLE 87
            :..:|.|.|.   .|.:.|.    :..|.|::.:||||||||||.||..:|.:|..:.:.|||.|
Zfish    31 IKGMREYTRSGFENASKSFAAKDLDVSMVGRSFMITGANSGIGKATAMAIAKKGGTVHIVCRNKE 95

  Fly    88 TANAVKDEIVKETKNNKILVKKLDLGSQKSVREFAADIVKTEPKIDVLIHNAGMALAFRGQTSED 152
            .|...::|||..:.|..:.|..|||...:.|.|||....|....::|||:|||..:..| :.:.|
Zfish    96 KAERAREEIVSASGNTMVFVHVLDLSESRKVWEFAEAFKKEHTSLNVLINNAGCMVNQR-EINSD 159

  Fly   153 GVELTMATNHYGPFLLTHLLIDVLKKSAPARIVIVASELYRLSSVNLAKLNP------IGTFPAA 211
            |:|...|||..|.::||..||.:|:||...|::.|:|     ..:.:.||||      ...|.|.
Zfish   160 GLEKNFATNTLGVYILTKCLIPLLEKSRDPRVITVSS-----GGMLVQKLNPDDLQTERAQFDAT 219

  Fly   212 YLYYVSKFANIYFARELAKRLEGTKVTVNFLHPGMIDSGIWRNVPFPLN-LPMM-AITKGFFKTT 274
            .:|..:|...:......||..  .|:..:.:|||      |.:.|...: :|.. .:.:...::.
Zfish   220 MVYAQNKRQQVVMTEFWAKAY--PKIHFSVMHPG------WADTPAVASAMPQFYQLMRDRLRSA 276

  Fly   275 KAGAQTTIYLATSN-EVANVSGKYFMD 300
            :.|:.|.|:||.|. .:...||.:|.|
Zfish   277 EQGSDTLIWLAMSRVTITFPSGLFFQD 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 84/258 (33%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 84/258 (33%)
dhrs12lbXP_002660947.2 SDR 60..314 CDD:330230 84/258 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.