DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and dhrsx

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001243648.1 Gene:dhrsx / 100318301 ZFINID:ZDB-GENE-060620-2 Length:324 Species:Danio rerio


Alignment Length:313 Identity:94/313 - (30%)
Similarity:153/313 - (48%) Gaps:17/313 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IRFYL---RITAGRCFTET-------KMEGKTVIITGANSGIGKETAKDLAGRGARIIMACRNLE 87
            ||.||   ::...:.|.::       :..||..|:||...|:|.|.::.|......:|:|....|
Zfish    12 IRLYLDGVKVLLYQLFNKSFRLPDLPEQNGKVAIVTGGTRGMGYEISRHLVSLDMHVIIAGNEEE 76

  Fly    88 TANAVKDEIVKETKNNKILVKKLDLGSQKSVREFAADIVKTEPKIDVLIHNAGMALAFRGQTSED 152
            ...|...:|.:|....|:....|||.|..|||:|..........:.||::|||:.|....:| ||
Zfish    77 EGLAAVKKIQEELNQGKVEFMYLDLASLTSVRQFVQRYNAKGLPLHVLVNNAGVMLVPERRT-ED 140

  Fly   153 GVELTMATNHYGPFLLTHLLIDVLKKSAP----ARIVIVASELYRLSSVNLAKLNPIGTFPAAYL 213
            |.||....|:.|.||||:||:..|:|:..    :||||::|..:....:.|..|.....:.:...
Zfish   141 GFELHFGLNYLGHFLLTNLLLGALRKTGKPGKCSRIVIMSSATHYGGRLTLDDLQGRLCYSSHAA 205

  Fly   214 YYVSKFANIYFARELAKRL--EGTKVTVNFLHPGMIDSGIWRNVPFPLNLPMMAITKGFFKTTKA 276
            |..||.|.:..:..|.::|  .|..||||.:.|||:|:.::.|:..|..:......|..|:|...
Zfish   206 YAQSKLALLLLSYHLQEQLLVRGDPVTVNAVDPGMVDTALYDNLCSPAQVAKKPFAKLLFRTPAE 270

  Fly   277 GAQTTIYLATSNEVANVSGKYFMDCKEATLNAAALDEEKGLKIWEESVKIVKL 329
            ||.|.||.|.::|:..:.|.|..:.::...:|.:.|:....|:|::|..:|.|
Zfish   271 GASTAIYAAAASELEGIGGLYLYNGRKTESSALSYDKRLQTKLWKQSCALVGL 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 87/280 (31%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 85/273 (31%)
dhrsxNP_001243648.1 SDR 41..314 CDD:330230 85/273 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.