Sequence 1: | NP_001262708.1 | Gene: | gl / 42210 | FlyBaseID: | FBgn0004618 | Length: | 679 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_115540.2 | Gene: | ZNF394 / 84124 | HGNCID: | 18832 | Length: | 561 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 83/207 - (40%) |
---|---|---|---|
Similarity: | 109/207 - (52%) | Gaps: | 47/207 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 394 PHKSPT--SYQAAALGLSLSAFEDEEDSNEDLDGDEGSSGGEMKPNLCRLCGKTYARPSTLKTHL 456
Fly 457 RTHSGERPYRCPDCNKSFSQAANLTAHVRTHTGQKPFRCPICDRRFSQSSSVTTHMRTHS----- 516
Fly 517 ----------------------GERPYRCSSCKKSFSDSSTLTKHLRIHSGEKPYQCKLCLLRFS 559
Fly 560 QSGNLNRHMRVH 571 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
gl | NP_001262708.1 | C2H2 Zn finger | 439..459 | CDD:275368 | 8/19 (42%) |
zf-C2H2 | 439..459 | CDD:278523 | 8/19 (42%) | ||
zf-H2C2_2 | 452..476 | CDD:290200 | 13/23 (57%) | ||
C2H2 Zn finger | 467..487 | CDD:275368 | 12/19 (63%) | ||
zf-H2C2_2 | 479..504 | CDD:290200 | 14/24 (58%) | ||
zf-C2H2_8 | 492..570 | CDD:292531 | 41/104 (39%) | ||
C2H2 Zn finger | 495..515 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 507..531 | CDD:290200 | 13/50 (26%) | ||
C2H2 Zn finger | 523..543 | CDD:275368 | 10/19 (53%) | ||
zf-H2C2_2 | 536..560 | CDD:290200 | 15/23 (65%) | ||
C2H2 Zn finger | 551..571 | CDD:275368 | 9/19 (47%) | ||
ZNF394 | NP_115540.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..61 | ||
SCAN | 60..170 | CDD:128708 | |||
KRAB_A-box | 155..214 | CDD:322003 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 182..201 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 231..285 | ||||
C2H2 Zn finger | 337..353 | CDD:275368 | 4/21 (19%) | ||
COG5048 | 356..>420 | CDD:227381 | 33/63 (52%) | ||
C2H2 Zn finger | 360..380 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 388..408 | CDD:275368 | 12/19 (63%) | ||
zf-C2H2 | 414..436 | CDD:306579 | 7/21 (33%) | ||
C2H2 Zn finger | 416..436 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 444..463 | CDD:275368 | 0/18 (0%) | ||
SFP1 | <464..543 | CDD:227516 | 32/56 (57%) | ||
C2H2 Zn finger | 471..491 | CDD:275368 | 10/19 (53%) | ||
C2H2 Zn finger | 499..519 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 527..547 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |