DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gl and IDD12

DIOPT Version :9

Sequence 1:NP_001262708.1 Gene:gl / 42210 FlyBaseID:FBgn0004618 Length:679 Species:Drosophila melanogaster
Sequence 2:NP_001328388.1 Gene:IDD12 / 828206 AraportID:AT4G02670 Length:404 Species:Arabidopsis thaliana


Alignment Length:260 Identity:54/260 - (20%)
Similarity:81/260 - (31%) Gaps:108/260 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   438 LCRLCGKTYARPSTLKTHLRTHS--------------GERPYRCPDCN-------KSFSQAANLT 481
            :|.:|.|.:.|...|:.|.|.|:              .::.|.||:.|       ::......:.
plant    85 VCEICNKGFQRDQNLQLHRRGHNLPWKLKQKNTKEQQKKKVYVCPETNCAHHHPSRALGDLTGIK 149

  Fly   482 AHVRTHTGQKPFRCPICDRRFSQSSSVTTHMRTHSGERPYRCSSCKKSFSDSSTLTKH------- 539
            .|.....|:|.::|..|.:.::..|....|.:. .|.|.||| .|...||...|...|       
plant   150 KHFCRKHGEKKWKCEKCSKFYAVQSDWKAHTKI-CGTRDYRC-DCGTLFSRKDTFITHRAFCDAL 212

  Fly   540 ----LRIHSGEKPYQCKLCLLRFSQSGNL-NRHMRVHGNNNSSNGSNG----------------- 582
                .|:||              :.|.|| |.:....|::...|.|:.                 
plant   213 AEESARLHS--------------TSSSNLTNPNPNFQGHHFMFNKSSSLLFTSSPLFIEPSLSTA 263

  Fly   583 ------------------ATGVGGESSTGSGVGGGNSLLTXQKPRSAGGFQHYHPPHTHHMHHQH 629
                              ||.:   |||..| |||.:       ||.|             ||:|
plant   264 ALSTPPTAALSATALLQKATSL---SSTTFG-GGGQT-------RSIG-------------HHRH 304

  Fly   630  629
            plant   305  304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
glNP_001262708.1 C2H2 Zn finger 439..459 CDD:275368 7/19 (37%)
zf-C2H2 439..459 CDD:278523 7/19 (37%)
zf-H2C2_2 452..476 CDD:290200 8/44 (18%)
C2H2 Zn finger 467..487 CDD:275368 4/26 (15%)
zf-H2C2_2 479..504 CDD:290200 5/24 (21%)
zf-C2H2_8 492..570 CDD:292531 21/89 (24%)
C2H2 Zn finger 495..515 CDD:275368 4/19 (21%)
zf-H2C2_2 507..531 CDD:290200 7/23 (30%)
C2H2 Zn finger 523..543 CDD:275368 7/30 (23%)
zf-H2C2_2 536..560 CDD:290200 4/34 (12%)
C2H2 Zn finger 551..571 CDD:275368 4/20 (20%)
IDD12NP_001328388.1 C2H2 Zn finger 86..106 CDD:275368 7/19 (37%)
C2H2 Zn finger 128..156 CDD:275368 4/27 (15%)
C2H2 Zn finger 163..182 CDD:275368 4/18 (22%)
C2H2 Zn finger 190..206 CDD:275368 5/16 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.