Sequence 1: | NP_001262708.1 | Gene: | gl / 42210 | FlyBaseID: | FBgn0004618 | Length: | 679 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_650862.1 | Gene: | CG4936 / 42393 | FlyBaseID: | FBgn0038768 | Length: | 521 | Species: | Drosophila melanogaster |
Alignment Length: | 242 | Identity: | 73/242 - (30%) |
---|---|---|---|
Similarity: | 106/242 - (43%) | Gaps: | 42/242 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 394 PHKSPTSYQAAALGLSLSAFEDEEDSNEDLDGDEGSSGGEMK----------------------- 435
Fly 436 -------------PNLCRLCGKTYARPSTLKTHLRTHSGERPYRCPDCNKSFSQAANLTAHVRTH 487
Fly 488 TGQKPFRCPICDRRFSQSSSVTTHMRTHSGERPYRCSSCKKSFSDSSTLTKHLRIHSGEKPYQCK 552
Fly 553 LCLLRFSQSGNLNRHMRVHGNNNSSNGSNGATGVGGESS--TGSGVG 597 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
gl | NP_001262708.1 | C2H2 Zn finger | 439..459 | CDD:275368 | 7/19 (37%) |
zf-C2H2 | 439..459 | CDD:278523 | 7/19 (37%) | ||
zf-H2C2_2 | 452..476 | CDD:290200 | 9/23 (39%) | ||
C2H2 Zn finger | 467..487 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 479..504 | CDD:290200 | 10/24 (42%) | ||
zf-C2H2_8 | 492..570 | CDD:292531 | 31/77 (40%) | ||
C2H2 Zn finger | 495..515 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 507..531 | CDD:290200 | 10/23 (43%) | ||
C2H2 Zn finger | 523..543 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 536..560 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 551..571 | CDD:275368 | 6/19 (32%) | ||
CG4936 | NP_650862.1 | zf-AD | 22..95 | CDD:214871 | |
C2H2 Zn finger | 362..382 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 375..399 | CDD:290200 | 9/23 (39%) | ||
COG5048 | 386..>447 | CDD:227381 | 24/60 (40%) | ||
C2H2 Zn finger | 390..410 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 403..426 | CDD:290200 | 9/22 (41%) | ||
C2H2 Zn finger | 418..438 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 432..455 | CDD:290200 | 11/22 (50%) | ||
C2H2 Zn finger | 446..466 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 459..481 | CDD:290200 | 10/21 (48%) | ||
C2H2 Zn finger | 474..494 | CDD:275368 | 6/19 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |