DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gl and crol

DIOPT Version :9

Sequence 1:NP_001262708.1 Gene:gl / 42210 FlyBaseID:FBgn0004618 Length:679 Species:Drosophila melanogaster
Sequence 2:NP_001245993.1 Gene:crol / 34592 FlyBaseID:FBgn0020309 Length:962 Species:Drosophila melanogaster


Alignment Length:654 Identity:134/654 - (20%)
Similarity:214/654 - (32%) Gaps:225/654 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DVSNGGPVEPETGYVPNNPLFGLALDSPQQECAASCVGCLSCQGSTALPISS-----LTSSDFDC 90
            ||.|........|.:|..|.....:.|.....||:.....:...:.|..::|     ..::....
  Fly    74 DVVNHQLAAAHGGQLPPPPPLPPQVTSHAASAAAAAAAASTNNAAVAAVMASANAAAAAAAAASA 138

  Fly    91 GGCFDPTIGVGVGIGGGHIQISTTPPASSGNGSSNNG-----AG--------GG-----SSGNHG 137
            ||...|...   |.||..:.::||..::|..||:.:|     ||        ||     .|||.|
  Fly   139 GGGLPPATS---GNGGQQVTVTTTSSSTSSGGSTTSGGTTTTAGELLMPKMEGGIHGVDGSGNGG 200

  Fly   138 YWSTDEMASTFPGLP------PLDIDPLPSLFPFSPCGASYNFAAGNPHQAASLSYTVHPHQMLI 196
            ......:|....|.|      ..||           ||..:.|.                :|:::
  Fly   201 NGGGQNVALAPDGTPIATGTHVCDI-----------CGKMFQFR----------------YQLIV 238

  Fly   197 SPNSHN----------------------HGQMH---------------------SQHQQHQH--- 215
            ....|:                      ||::|                     .:|.:...   
  Fly   239 HRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDK 303

  Fly   216 -------QQSQVQASHVGNSLLQSSGGNNIGSNGSAGGVANAASCYYETSAGTAAPPPPPAAAMY 273
                   |::..:..|:.|.....:|                     ||          |....|
  Fly   304 PFACTICQKTFARKEHLDNHFRSHTG---------------------ET----------PFRCQY 337

  Fly   274 PSMSVNVSMNMTMH---HGYGAGDAGGVPMQCSQMNWTPPSNSTSAAAAAAAVNVLYPPLLSPGH 335
            .:.:.....:|..|   |      .|..|.:|                     ::.........|
  Fly   338 CAKTFTRKEHMVNHVRKH------TGETPHRC---------------------DICKKSFTRKEH 375

  Fly   336 YPASATYSFTADFRAPAPTGLGALPPLTVGEKESPSPPANSSLAG-YYPTGVGNQGYTPPHKSPT 399
            |.....:.          ||               ..|....:.| .|........:...|.:.|
  Fly   376 YVNHYMWH----------TG---------------QTPHQCDVCGKKYTRKEHLANHMRSHTNET 415

  Fly   400 SYQAAALGLSLSAFEDEEDSN-----------------------EDLDGDEGSSGGEMKPNLCRL 441
            .::....|.|.|  ..|..:|                       |.|........|| .|:.|..
  Fly   416 PFRCEICGKSFS--RKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGE-SPHRCSY 477

  Fly   442 CGKTYARPSTLKTHLRTHSGERPYRCPDCNKSFSQAANLTAHVRTHTGQKPFRCPICDRRFSQSS 506
            |.||:.|...|..|:|.|:||.|::|..|.|:|::..::..|||.|||:.|.:|..|.:.|::..
  Fly   478 CMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKE 542

  Fly   507 SVTTHMRTHSGERPYRCSSCKKSFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSGNLNRHMRVH 571
            .:|.|:|.|:|:.|:|||.|||:|:....||.|:|:|:|:.|::|:.|...|::..:||.|||.|
  Fly   543 HLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQH 607

  Fly   572 GNNN 575
            .::|
  Fly   608 SSDN 611

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
glNP_001262708.1 C2H2 Zn finger 439..459 CDD:275368 8/19 (42%)
zf-C2H2 439..459 CDD:278523 8/19 (42%)
zf-H2C2_2 452..476 CDD:290200 11/23 (48%)
C2H2 Zn finger 467..487 CDD:275368 7/19 (37%)
zf-H2C2_2 479..504 CDD:290200 10/24 (42%)
zf-C2H2_8 492..570 CDD:292531 31/77 (40%)
C2H2 Zn finger 495..515 CDD:275368 6/19 (32%)
zf-H2C2_2 507..531 CDD:290200 12/23 (52%)
C2H2 Zn finger 523..543 CDD:275368 10/19 (53%)
zf-H2C2_2 536..560 CDD:290200 10/23 (43%)
C2H2 Zn finger 551..571 CDD:275368 8/19 (42%)
crolNP_001245993.1 C2H2 Zn finger 223..243 CDD:275368 6/46 (13%)
C2H2 Zn finger 251..271 CDD:275368 2/19 (11%)
C2H2 Zn finger 279..299 CDD:275368 1/19 (5%)
COG5048 300..723 CDD:227381 89/398 (22%)
C2H2 Zn finger 307..327 CDD:275368 3/19 (16%)
C2H2 Zn finger 335..355 CDD:275368 3/19 (16%)
C2H2 Zn finger 363..383 CDD:275368 3/40 (8%)
C2H2 Zn finger 391..411 CDD:275368 2/19 (11%)
C2H2 Zn finger 419..439 CDD:275368 5/21 (24%)
C2H2 Zn finger 447..467 CDD:275368 2/19 (11%)
C2H2 Zn finger 475..495 CDD:275368 8/19 (42%)
C2H2 Zn finger 503..523 CDD:275368 7/19 (37%)
C2H2 Zn finger 531..551 CDD:275368 6/19 (32%)
C2H2 Zn finger 559..579 CDD:275368 10/19 (53%)
C2H2 Zn finger 587..607 CDD:275368 8/19 (42%)
C2H2 Zn finger 615..636 CDD:275368
C2H2 Zn finger 644..664 CDD:275368
C2H2 Zn finger 676..696 CDD:275368
C2H2 Zn finger 704..722 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23226
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.