Sequence 1: | NP_001262708.1 | Gene: | gl / 42210 | FlyBaseID: | FBgn0004618 | Length: | 679 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001314845.1 | Gene: | wu:fc30c06 / 324469 | ZFINID: | ZDB-GENE-030131-3190 | Length: | 424 | Species: | Danio rerio |
Alignment Length: | 248 | Identity: | 82/248 - (33%) |
---|---|---|---|
Similarity: | 112/248 - (45%) | Gaps: | 28/248 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 414 EDEEDSNEDLDGDEGSSGGEMKPNLCRLCGKTYARPSTLKTHLRTHSGERPYRCPDCNKSFSQAA 478
Fly 479 NLTAHVRTHTGQKPFRCPICDRRFSQSSSVTTHMRTHSGERPYRCSSCKKSFSDSSTLTKHLRIH 543
Fly 544 SGEKPYQCKLCLLRFSQSGNLNRHMRVHGNNN----SSNGSNGATGVG---------GE-----S 590
Fly 591 STGSGVGGGNSL------LTXQKP----RSAGGFQHYHPPHTHHMHHQHHAHH 633 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
gl | NP_001262708.1 | C2H2 Zn finger | 439..459 | CDD:275368 | 7/19 (37%) |
zf-C2H2 | 439..459 | CDD:278523 | 7/19 (37%) | ||
zf-H2C2_2 | 452..476 | CDD:290200 | 13/23 (57%) | ||
C2H2 Zn finger | 467..487 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 479..504 | CDD:290200 | 9/24 (38%) | ||
zf-C2H2_8 | 492..570 | CDD:292531 | 33/77 (43%) | ||
C2H2 Zn finger | 495..515 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 507..531 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 523..543 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 536..560 | CDD:290200 | 14/23 (61%) | ||
C2H2 Zn finger | 551..571 | CDD:275368 | 7/19 (37%) | ||
wu:fc30c06 | NP_001314845.1 | C2H2 Zn finger | 94..114 | CDD:275368 | 7/19 (37%) |
zf-H2C2_2 | 106..131 | CDD:290200 | 13/24 (54%) | ||
C2H2 Zn finger | 122..142 | CDD:275368 | 6/19 (32%) | ||
COG5048 | 146..>390 | CDD:227381 | 57/171 (33%) | ||
C2H2 Zn finger | 150..170 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 178..198 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 191..215 | CDD:290200 | 14/23 (61%) | ||
C2H2 Zn finger | 206..226 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 234..254 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 246..271 | CDD:290200 | 5/24 (21%) | ||
C2H2 Zn finger | 262..282 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 290..310 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 318..338 | CDD:275368 | |||
C2H2 Zn finger | 346..366 | CDD:275368 | |||
zf-H2C2_2 | 359..381 | CDD:290200 | |||
C2H2 Zn finger | 374..394 | CDD:275368 | |||
C2H2 Zn finger | 402..422 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |