DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gl and ZNF500

DIOPT Version :9

Sequence 1:NP_001262708.1 Gene:gl / 42210 FlyBaseID:FBgn0004618 Length:679 Species:Drosophila melanogaster
Sequence 2:NP_067678.1 Gene:ZNF500 / 26048 HGNCID:23716 Length:480 Species:Homo sapiens


Alignment Length:320 Identity:111/320 - (34%)
Similarity:142/320 - (44%) Gaps:60/320 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 PPSNSTSAAAAAAAVNVLYPPLLS-----PGHYPASATYSFTADFRAPAPTGLGALPPLTVGEKE 368
            ||:......|:|:       |.||     |.:....|.|....:.|...|....|  ||   |.|
Human   201 PPAPRHQEMASAS-------PFLSAWSQVPVNLEDVAVYLSGEEPRCMDPAQRDA--PL---ENE 253

  Fly   369 SPS----------PPANSSLAGYYPTGVGNQGYTPPHKSPTSYQAAALGLSLSAFEDEEDSNEDL 423
            .|.          ..|...:..|.......||  |.|..|....|...||    ...::......
Human   254 GPGIQLEDGGDGREDAPLRMEWYRVLSARCQG--PGHPLPGQRPAPVRGL----VRPDQPRGGPP 312

  Fly   424 DGDEGSSGGEMKPNLCRLCGKTYARPSTLKTHLRTHSGERPYRCPDCNKSFSQAANLTAHVRTHT 488
            .|...|.|.: ||..|..|||.:::.|.|..|.|||:|||||:|..|.|.||..:|.:.|.|.||
Human   313 PGRRASHGAD-KPYTCPECGKGFSKTSHLTKHQRTHTGERPYKCLVCGKGFSDRSNFSTHQRVHT 376

  Fly   489 GQKPFRCPICDRRFSQSSSVTTHMRTHSGERPYRCSSCKKSFSDSSTLTKHLRIHSGEKPYQCKL 553
            |:||:.||.|.:|||||||:..|.|||||||||.|:.|.|.|::||..:.|.|.|:|||||.|..
Human   377 GEKPYPCPECGKRFSQSSSLVIHRRTHSGERPYACTQCGKRFNNSSHFSAHRRTHTGEKPYTCPA 441

  Fly   554 CLLRFSQSGNLNRHMRVHGNNNSSNGSNGATGVGGESSTGSGVGGGNSLLTXQKPRSAGG 613
            |...|.:..:|::|.|.|                        :|.| ||.| | |.:.||
Human   442 CGRGFRRGTDLHKHQRTH------------------------MGAG-SLPTLQ-PVAPGG 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
glNP_001262708.1 C2H2 Zn finger 439..459 CDD:275368 8/19 (42%)
zf-C2H2 439..459 CDD:278523 8/19 (42%)
zf-H2C2_2 452..476 CDD:290200 14/23 (61%)
C2H2 Zn finger 467..487 CDD:275368 8/19 (42%)
zf-H2C2_2 479..504 CDD:290200 13/24 (54%)
zf-C2H2_8 492..570 CDD:292531 40/77 (52%)
C2H2 Zn finger 495..515 CDD:275368 12/19 (63%)
zf-H2C2_2 507..531 CDD:290200 14/23 (61%)
C2H2 Zn finger 523..543 CDD:275368 8/19 (42%)
zf-H2C2_2 536..560 CDD:290200 11/23 (48%)
C2H2 Zn finger 551..571 CDD:275368 6/19 (32%)
ZNF500NP_067678.1 SCAN 46..151 CDD:128708
SCAN 46..134 CDD:280241
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..208 2/6 (33%)
KRAB_A-box 224..>247 CDD:143639 4/22 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..268 7/30 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 284..322 11/43 (26%)
COG5048 <320..459 CDD:227381 71/139 (51%)
zf-C2H2 325..347 CDD:278523 8/21 (38%)
C2H2 Zn finger 327..347 CDD:275368 8/19 (42%)
zf-H2C2_2 339..363 CDD:290200 13/23 (57%)
C2H2 Zn finger 355..375 CDD:275368 8/19 (42%)
zf-H2C2_2 367..392 CDD:290200 13/24 (54%)
C2H2 Zn finger 383..403 CDD:275368 12/19 (63%)
zf-H2C2_2 395..420 CDD:290200 15/24 (63%)
C2H2 Zn finger 411..431 CDD:275368 8/19 (42%)
zf-H2C2_2 423..448 CDD:290200 11/24 (46%)
C2H2 Zn finger 439..459 CDD:275368 6/19 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 453..480 12/49 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2374
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.