DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gl and ZKSCAN5

DIOPT Version :9

Sequence 1:NP_001262708.1 Gene:gl / 42210 FlyBaseID:FBgn0004618 Length:679 Species:Drosophila melanogaster
Sequence 2:NP_001305011.1 Gene:ZKSCAN5 / 23660 HGNCID:12867 Length:839 Species:Homo sapiens


Alignment Length:288 Identity:91/288 - (31%)
Similarity:130/288 - (45%) Gaps:56/288 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   429 SSGGEMKPNLCRLCGKTYARPSTLKTHLRTHSGERPYRCPDCNKSFSQAANLTAHVRTHTGQKPF 493
            ||.|| :|:.|..|||::.:.:.|..|.|.|:||:|:||.:|.||::|..:||.|.|.|||:||:
Human   542 SSTGE-RPHKCNECGKSFIQSAHLIQHQRIHTGEKPFRCEECGKSYNQRVHLTQHQRVHTGEKPY 605

  Fly   494 RCPICDRRFSQSSSVTTHMRTHSGERPYRCSSCKKSFSDSSTLTKHLRIHSGEKPYQCKLCLLRF 558
            .||:|.:.|...|.:..|...||||||::|:.|.|.|...|.|..|||:||.||.:||:.|...|
Human   606 TCPLCGKAFRVRSHLVQHQSVHSGERPFKCNECGKGFGRRSHLAGHLRLHSREKSHQCRECGEIF 670

  Fly   559 SQSGNLNRHMRVH-GNNNSSNG------SNGATGVGGE-----------SSTGSGVGGGNSLL-- 603
            .|..:|..|..:| |..|..||      |...|.:..:           ...|...|..:.|:  
Human   671 FQYVSLIEHQVLHMGQKNEKNGICEEAYSWNLTVIEDKKIELQEQPYQCDICGKAFGYSSDLIQH 735

  Fly   604 ----TXQKP-------RSAGGFQH-------YHPPHTHHMHH-------QHHAHHHHHAHMGNYD 643
                | :||       .:.|...|       |....:|..|.       :.|.:.|...|.|...
Human   736 YRTHTAEKPYQCDICRENVGQCSHTKQHQKIYSSTKSHQCHECGRGFTLKSHLNQHQRIHTGEKP 800

  Fly   644 YGNYSIGDYTPPGATQNYSGYYFCALNK 671
            :.....|        .|:|  :.|:|.|
Human   801 FQCKECG--------MNFS--WSCSLFK 818

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
glNP_001262708.1 C2H2 Zn finger 439..459 CDD:275368 7/19 (37%)
zf-C2H2 439..459 CDD:278523 7/19 (37%)
zf-H2C2_2 452..476 CDD:290200 12/23 (52%)
C2H2 Zn finger 467..487 CDD:275368 9/19 (47%)
zf-H2C2_2 479..504 CDD:290200 13/24 (54%)
zf-C2H2_8 492..570 CDD:292531 33/77 (43%)
C2H2 Zn finger 495..515 CDD:275368 6/19 (32%)
zf-H2C2_2 507..531 CDD:290200 10/23 (43%)
C2H2 Zn finger 523..543 CDD:275368 9/19 (47%)
zf-H2C2_2 536..560 CDD:290200 12/23 (52%)
C2H2 Zn finger 551..571 CDD:275368 6/19 (32%)
ZKSCAN5NP_001305011.1 SCAN 46..155 CDD:128708
SCAN 47..134 CDD:280241
KRAB 222..257 CDD:279668
COG5048 318..762 CDD:227381 78/220 (35%)
C2H2 Zn finger 348..368 CDD:275368
zf-H2C2_2 360..385 CDD:290200
C2H2 Zn finger 376..396 CDD:275368
zf-H2C2_2 388..411 CDD:290200
C2H2 Zn finger 404..424 CDD:275368
C2H2 Zn finger 432..452 CDD:275368
zf-C2H2 549..571 CDD:278523 7/21 (33%)
C2H2 Zn finger 551..571 CDD:275368 7/19 (37%)
zf-H2C2_2 563..588 CDD:290200 12/24 (50%)
C2H2 Zn finger 579..599 CDD:275368 9/19 (47%)
zf-H2C2_2 591..614 CDD:290200 12/22 (55%)
C2H2 Zn finger 607..627 CDD:275368 6/19 (32%)
zf-H2C2_2 619..644 CDD:290200 11/24 (46%)
C2H2 Zn finger 635..655 CDD:275368 9/19 (47%)
C2H2 Zn finger 663..683 CDD:275368 6/19 (32%)
zf-C2H2 717..739 CDD:278523 3/21 (14%)
C2H2 Zn finger 719..739 CDD:275368 3/19 (16%)
C2H2 Zn finger 747..795 CDD:275368 7/47 (15%)
COG5048 758..>823 CDD:227381 14/71 (20%)
zf-C2H2 773..795 CDD:278523 4/21 (19%)
zf-H2C2_2 787..811 CDD:290200 6/31 (19%)
C2H2 Zn finger 803..823 CDD:275368 6/26 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.