DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gl and HIC2

DIOPT Version :9

Sequence 1:NP_001262708.1 Gene:gl / 42210 FlyBaseID:FBgn0004618 Length:679 Species:Drosophila melanogaster
Sequence 2:NP_055909.2 Gene:HIC2 / 23119 HGNCID:18595 Length:615 Species:Homo sapiens


Alignment Length:435 Identity:115/435 - (26%)
Similarity:171/435 - (39%) Gaps:111/435 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 QSQVQASHVGNSLLQSSGGNNIG-----SNGSAGGVANAASCYYETSAGTA--APPPPPAAA--- 271
            |..||.  :|.::..:.|...:|     :|||:||      |..|.....:  :||.|||..   
Human   208 QDSVQG--LGRAVCPAGGEAGLGGCSSSTNGSSGG------CEQELGLDLSKKSPPLPPATPGPH 264

  Fly   272 MYPSMSVNVSMNMTMHHGYGAGDAGGVP-----MQCSQMNWTPPSNSTSAAAAAAAVNVLYPPLL 331
            :.|..:..:|.:.     :|:..|...|     ...|::..||........|....:::|.    
Human   265 LTPDDAAQLSDSQ-----HGSPPAASAPPVANSASYSELGGTPDEPMDLEGAEDNHLSLLE---- 320

  Fly   332 SPGHYPASATYSFT--ADFRAPAPTGLGALPPLTVGEKESPSPPANSSLAG-YYPTGVGNQGYTP 393
            :||..|..:....|  .::....|...........|.| .|.|.......| ..|.|:...|..|
Human   321 APGGQPRKSLRHSTRKKEWGKKEPVAGSPFERREAGPK-GPCPGEEGEGVGDRVPNGILASGAGP 384

  Fly   394 --PHKSPTSYQAAALGLSLSAFEDEE---DSNED--LDGDEGSSG------------------GE 433
              |:..| .|...         |:||   |::||  ..|.||.||                  |:
Human   385 SGPYGEP-PYPCK---------EEEENGKDASEDSAQSGSEGGSGHASAHYMYRQEGYETVSYGD 439

  Fly   434 MKPNL--CRLCGKTYARPSTLKTHLRTHSGE---------------------------------- 462
               ||  |..|.|.:.....|..|:.||:.|                                  
Human   440 ---NLYVCIPCAKGFPSSEQLNAHVETHTEEELFIKEEGAYETGSGGAEEEAEDLSAPSAAYTAE 501

  Fly   463 -RPYRCPDCNKSFSQAANLTAHVRTHTGQKPFRCPICDRRFSQSSSVTTHMRTHSGERPYRCSSC 526
             ||::|..|.|::...|.|..|.:||...:||.|.||.:.|:|..::|.|||:|.|.:|:.|..|
Human   502 PRPFKCSVCEKTYKDPATLRQHEKTHWLTRPFPCNICGKMFTQRGTMTRHMRSHLGLKPFACDEC 566

  Fly   527 KKSFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSGNLNRHMRVH 571
            ...|:....||:|:|:|||||||:|:||..:|:|..||..|:|:|
Human   567 GMRFTRQYRLTEHMRVHSGEKPYECQLCGGKFTQQRNLISHLRMH 611

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
glNP_001262708.1 C2H2 Zn finger 439..459 CDD:275368 5/19 (26%)
zf-C2H2 439..459 CDD:278523 5/19 (26%)
zf-H2C2_2 452..476 CDD:290200 10/58 (17%)
C2H2 Zn finger 467..487 CDD:275368 6/19 (32%)
zf-H2C2_2 479..504 CDD:290200 10/24 (42%)
zf-C2H2_8 492..570 CDD:292531 36/77 (47%)
C2H2 Zn finger 495..515 CDD:275368 9/19 (47%)
zf-H2C2_2 507..531 CDD:290200 9/23 (39%)
C2H2 Zn finger 523..543 CDD:275368 7/19 (37%)
zf-H2C2_2 536..560 CDD:290200 15/23 (65%)
C2H2 Zn finger 551..571 CDD:275368 9/19 (47%)
HIC2NP_055909.2 BTB 40..140 CDD:279045
BTB 47..141 CDD:197585
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..167
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..208 115/435 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..421 50/217 (23%)
Binding to CtBP 246..250 0/3 (0%)
TMEM119 <300..395 CDD:292352 21/100 (21%)
C2H2 Zn finger 444..464 CDD:275368 5/19 (26%)
zf-C2H2 505..527 CDD:278523 6/21 (29%)
C2H2 Zn finger 507..527 CDD:275368 6/19 (32%)
zf-C2H2 533..555 CDD:278523 10/21 (48%)
C2H2 Zn finger 535..555 CDD:275368 9/19 (47%)
zf-H2C2_2 548..572 CDD:290200 10/23 (43%)
COG5048 559..>613 CDD:227381 25/53 (47%)
C2H2 Zn finger 563..583 CDD:275368 7/19 (37%)
zf-H2C2_2 576..600 CDD:290200 15/23 (65%)
C2H2 Zn finger 591..611 CDD:275368 9/19 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 137 1.000 Inparanoid score I4549
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.