Sequence 1: | NP_001262708.1 | Gene: | gl / 42210 | FlyBaseID: | FBgn0004618 | Length: | 679 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_036012519.1 | Gene: | Vezf1 / 22344 | MGIID: | 1313291 | Length: | 556 | Species: | Mus musculus |
Alignment Length: | 243 | Identity: | 64/243 - (26%) |
---|---|---|---|
Similarity: | 106/243 - (43%) | Gaps: | 42/243 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 367 KESPSP--PANSSLAGYYPTGVGNQGYTPPHKSPTSYQAAALGLSLSAFEDEEDSNEDLDGDEGS 429
Fly 430 ----------SGGEMKPNLCRLCGKTYARPSTLKTHLRTHSGERPYRCPDCNKSFSQAANLTAHV 484
Fly 485 RTHTG--QKPFRCPICDRRFSQSSSVTTHMR-THSGERPYRC------SSCKKSFSDSSTLTKHL 540
Fly 541 RIHSGEKPYQCKLC--LLRFSQSGNLNRHMRVHGNNNSSNGSNGATGV 586 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
gl | NP_001262708.1 | C2H2 Zn finger | 439..459 | CDD:275368 | 6/19 (32%) |
zf-C2H2 | 439..459 | CDD:278523 | 6/19 (32%) | ||
zf-H2C2_2 | 452..476 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 467..487 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 479..504 | CDD:290200 | 11/26 (42%) | ||
zf-C2H2_8 | 492..570 | CDD:292531 | 23/86 (27%) | ||
C2H2 Zn finger | 495..515 | CDD:275368 | 5/20 (25%) | ||
zf-H2C2_2 | 507..531 | CDD:290200 | 8/30 (27%) | ||
C2H2 Zn finger | 523..543 | CDD:275368 | 5/25 (20%) | ||
zf-H2C2_2 | 536..560 | CDD:290200 | 8/25 (32%) | ||
C2H2 Zn finger | 551..571 | CDD:275368 | 5/21 (24%) | ||
Vezf1 | XP_036012519.1 | zf-C2H2 | 106..125 | CDD:395048 | |
C2H2 Zn finger | 108..128 | CDD:275368 | |||
zf-C2H2 | 206..228 | CDD:395048 | 6/21 (29%) | ||
C2H2 Zn finger | 208..228 | CDD:275368 | 6/19 (32%) | ||
SFP1 | <230..287 | CDD:227516 | 20/56 (36%) | ||
C2H2 Zn finger | 236..256 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 266..284 | CDD:275368 | 5/17 (29%) | ||
C2H2 Zn finger | 295..321 | CDD:275368 | 5/25 (20%) | ||
motB | <415..532 | CDD:183756 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S3992 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.950 |