DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gl and Vezf1

DIOPT Version :9

Sequence 1:NP_001262708.1 Gene:gl / 42210 FlyBaseID:FBgn0004618 Length:679 Species:Drosophila melanogaster
Sequence 2:XP_036012519.1 Gene:Vezf1 / 22344 MGIID:1313291 Length:556 Species:Mus musculus


Alignment Length:243 Identity:64/243 - (26%)
Similarity:106/243 - (43%) Gaps:42/243 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 KESPSP--PANSSLAGYYPTGVGNQGYTPPHKSPTSYQAAALGLSLSAFEDEEDSNEDLDGDEGS 429
            |::|:.  |..|::||              ..|.||..:...|:..:.......:|........|
Mouse   138 KKTPTTVVPLISTIAG--------------DSSRTSLVSTIAGILSTVTTSSSGTNPSSSASTTS 188

  Fly   430 ----------SGGEMKPNLCRLCGKTYARPSTLKTHLRTHSGERPYRCPDCNKSFSQAANLTAHV 484
                      |....|.:.|.:|||.:.....|..|..:||.|:|:.||.||:.|.:...:|.||
Mouse   189 MPVPQSVKKPSKPVKKNHACEMCGKAFRDVYHLNRHKLSHSDEKPFECPICNQRFKRKDRMTYHV 253

  Fly   485 RTHTG--QKPFRCPICDRRFSQSSSVTTHMR-THSGERPYRC------SSCKKSFSDSSTLTKHL 540
            |:|.|  .||:.|.:|.:.||:...::.|:: .||.|||::|      .:|..:|:....|..|:
Mouse   254 RSHEGGITKPYTCSVCGKGFSRPDHLSCHVKHVHSTERPFKCQFSSLMQTCTAAFATKDRLRTHM 318

  Fly   541 RIHSGEKPYQCKLC--LLRFSQSGNLNRHMRVHGNNNSSNGSNGATGV 586
            ..|.|:  ..|.:|  ||   .:..:..|::.||.:.|.|.:....|:
Mouse   319 VRHEGK--VSCNICGKLL---SAAYITSHLKTHGQSQSINCNTCKQGI 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
glNP_001262708.1 C2H2 Zn finger 439..459 CDD:275368 6/19 (32%)
zf-C2H2 439..459 CDD:278523 6/19 (32%)
zf-H2C2_2 452..476 CDD:290200 11/23 (48%)
C2H2 Zn finger 467..487 CDD:275368 9/19 (47%)
zf-H2C2_2 479..504 CDD:290200 11/26 (42%)
zf-C2H2_8 492..570 CDD:292531 23/86 (27%)
C2H2 Zn finger 495..515 CDD:275368 5/20 (25%)
zf-H2C2_2 507..531 CDD:290200 8/30 (27%)
C2H2 Zn finger 523..543 CDD:275368 5/25 (20%)
zf-H2C2_2 536..560 CDD:290200 8/25 (32%)
C2H2 Zn finger 551..571 CDD:275368 5/21 (24%)
Vezf1XP_036012519.1 zf-C2H2 106..125 CDD:395048
C2H2 Zn finger 108..128 CDD:275368
zf-C2H2 206..228 CDD:395048 6/21 (29%)
C2H2 Zn finger 208..228 CDD:275368 6/19 (32%)
SFP1 <230..287 CDD:227516 20/56 (36%)
C2H2 Zn finger 236..256 CDD:275368 9/19 (47%)
C2H2 Zn finger 266..284 CDD:275368 5/17 (29%)
C2H2 Zn finger 295..321 CDD:275368 5/25 (20%)
motB <415..532 CDD:183756
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3992
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.