DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment gl and Zfp286

DIOPT Version :9

Sequence 1:	NP_001262708.1	Gene:	gl / 42210	FlyBaseID:	FBgn0004618	Length:	679	Species:	Drosophila melanogaster
Sequence 2:	XP_006532606.3	Gene:	Zfp286 / 192651	MGIID:	2384758	Length:	539	Species:	Mus musculus

Alignment Length:	140	Identity:	68/140 - (48%)
Similarity:	92/140 - (65%)	Gaps:	1/140 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   432 GEMKPNLCRLCGKTYARPSTLKTHLRTHSGERPYRCPDCNKSFSQAANLTAHVRTHTGQKPFRCP 496
            || :|..|..|||.:.|.:.|..|...|:|.:||.|.:|:|:|..::.|..|.|||||:||::|.
Mouse   340 GE-RPYECAECGKGFNRSTHLAQHQLIHTGVKPYECNECDKAFIHSSALIKHQRTHTGEKPYKCQ 403

  Fly   497 ICDRRFSQSSSVTTHMRTHSGERPYRCSSCKKSFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQS 561
            .|.:.||..||:|.|.|.|:|||||.||.|.|:||.|:.|.:|.|||:|||||:|..|...||:|
Mouse   404 DCGKAFSHCSSLTKHQRVHTGERPYECSECGKTFSQSTHLVQHQRIHTGEKPYECNECGKTFSRS 468

  Fly   562 GNLNRHMRVH 571
            .|..:|.|:|
Mouse   469 SNFAKHQRIH 478

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
gl	NP_001262708.1	C2H2 Zn finger	439..459	CDD:275368	7/19 (37%)
		zf-C2H2	439..459	CDD:278523	7/19 (37%)
		zf-H2C2_2	452..476	CDD:290200	10/23 (43%)
		C2H2 Zn finger	467..487	CDD:275368	7/19 (37%)
		zf-H2C2_2	479..504	CDD:290200	12/24 (50%)
		zf-C2H2_8	492..570	CDD:292531	40/77 (52%)
		C2H2 Zn finger	495..515	CDD:275368	9/19 (47%)
		zf-H2C2_2	507..531	CDD:290200	14/23 (61%)
		C2H2 Zn finger	523..543	CDD:275368	10/19 (53%)
		zf-H2C2_2	536..560	CDD:290200	13/23 (57%)
		C2H2 Zn finger	551..571	CDD:275368	8/19 (42%)
Zfp286	XP_006532606.3	zf-H2C2_2	330..355	CDD:372612	7/15 (47%)
		C2H2 Zn finger	346..366	CDD:275368	7/19 (37%)
		COG5048	<370..530	CDD:227381	56/109 (51%)
		C2H2 Zn finger	374..394	CDD:275368	7/19 (37%)
		C2H2 Zn finger	402..422	CDD:275368	9/19 (47%)
		C2H2 Zn finger	430..450	CDD:275368	10/19 (53%)
		C2H2 Zn finger	458..478	CDD:275368	8/19 (42%)
		C2H2 Zn finger	486..506	CDD:275368
		C2H2 Zn finger	514..534	CDD:275368
		C2H2 Zn finger	239..255	CDD:275368
		C2H2 Zn finger	263..283	CDD:275368
		zf-H2C2_2	276..300	CDD:372612
		zf-C2H2	289..311	CDD:333835
		C2H2 Zn finger	291..311	CDD:275368
		C2H2 Zn finger	318..338	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910