DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment gl and ZSCAN29

DIOPT Version :9

Sequence 1:	NP_001262708.1	Gene:	gl / 42210	FlyBaseID:	FBgn0004618	Length:	679	Species:	Drosophila melanogaster
Sequence 2:	NP_001359009.1	Gene:	ZSCAN29 / 146050	HGNCID:	26673	Length:	852	Species:	Homo sapiens

Alignment Length:	136	Identity:	66/136 - (48%)
Similarity:	92/136 - (67%)	Gaps:	0/136 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   436 PNLCRLCGKTYARPSTLKTHLRTHSGERPYRCPDCNKSFSQAANLTAHVRTHTGQKPFRCPICDR 500
            |..|..|||:::|.:.|..|.|.|:||:||:|.||.|||..::|...|.|.|||:||::|..|.:
Human   677 PYKCADCGKSFSRSARLIRHRRIHTGEKPYKCLDCGKSFRDSSNFITHRRIHTGEKPYQCGECGK 741

  Fly   501 RFSQSSSVTTHMRTHSGERPYRCSSCKKSFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSGNLN 565
            .|:||||:..|.|||:||:||:|..|.|||::||..:.|.|||:||:|:.|..|...||:|.:|.
Human   742 CFNQSSSLIIHQRTHTGEKPYQCEECGKSFNNSSHFSAHRRIHTGERPHVCPDCGKSFSKSSDLR 806

  Fly   566 RHMRVH 571
            .|.|.|
Human   807 AHHRTH 812

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
gl	NP_001262708.1	C2H2 Zn finger	439..459	CDD:275368	8/19 (42%)
		zf-C2H2	439..459	CDD:278523	8/19 (42%)
		zf-H2C2_2	452..476	CDD:290200	14/23 (61%)
		C2H2 Zn finger	467..487	CDD:275368	9/19 (47%)
		zf-H2C2_2	479..504	CDD:290200	11/24 (46%)
		zf-C2H2_8	492..570	CDD:292531	37/77 (48%)
		C2H2 Zn finger	495..515	CDD:275368	9/19 (47%)
		zf-H2C2_2	507..531	CDD:290200	13/23 (57%)
		C2H2 Zn finger	523..543	CDD:275368	9/19 (47%)
		zf-H2C2_2	536..560	CDD:290200	10/23 (43%)
		C2H2 Zn finger	551..571	CDD:275368	8/19 (42%)
ZSCAN29	NP_001359009.1	SCAN	14..124	CDD:128708
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	96..182
		Myb_DNA-bind_4	245..330	CDD:372747
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	347..400
		Myb_DNA-bind_4	408..493	CDD:372747
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	502..557
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	603..625
		COG5048	<630..838	CDD:227381	66/136 (49%)
		C2H2 Zn finger	680..700	CDD:275368	8/19 (42%)
		C2H2 Zn finger	708..728	CDD:275368	9/19 (47%)
		C2H2 Zn finger	736..756	CDD:275368	9/19 (47%)
		C2H2 Zn finger	764..784	CDD:275368	9/19 (47%)
		C2H2 Zn finger	792..812	CDD:275368	8/19 (42%)
		C2H2 Zn finger	820..840	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910