DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gl and znf329

DIOPT Version :9

Sequence 1:NP_001262708.1 Gene:gl / 42210 FlyBaseID:FBgn0004618 Length:679 Species:Drosophila melanogaster
Sequence 2:NP_001123794.2 Gene:znf329 / 100170545 XenbaseID:XB-GENE-5965306 Length:463 Species:Xenopus tropicalis


Alignment Length:152 Identity:62/152 - (40%)
Similarity:87/152 - (57%) Gaps:1/152 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   420 NEDLDGDEGSSGGEMKPNLCRLCGKTYARPSTLKTHLRTHSGERPYRCPDCNKSFSQAANLTAHV 484
            |.||...:....|| ||..|.:|||.|...:.|..|.|.|:.:|.:.|.||.|.|...:.|..|.
 Frog   278 NRDLIRHQKFHTGE-KPFSCSVCGKCYRDNALLIRHQRIHTADRLFPCSDCGKFFVDHSQLLIHQ 341

  Fly   485 RTHTGQKPFRCPICDRRFSQSSSVTTHMRTHSGERPYRCSSCKKSFSDSSTLTKHLRIHSGEKPY 549
            .:|||.|...|..|.:.|..:|::..|.|.|:||:|:.||.|.|.|:|:|.||:|.|||:||||:
 Frog   342 TSHTGAKRHSCAECGKWFHYTSALIKHQRIHTGEKPFSCSFCGKRFNDNSILTRHERIHTGEKPF 406

  Fly   550 QCKLCLLRFSQSGNLNRHMRVH 571
            .|.:|...|::..:|:.|.|.|
 Frog   407 SCTVCGKCFTRRSHLSEHQRSH 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
glNP_001262708.1 C2H2 Zn finger 439..459 CDD:275368 8/19 (42%)
zf-C2H2 439..459 CDD:278523 8/19 (42%)
zf-H2C2_2 452..476 CDD:290200 10/23 (43%)
C2H2 Zn finger 467..487 CDD:275368 7/19 (37%)
zf-H2C2_2 479..504 CDD:290200 9/24 (38%)
zf-C2H2_8 492..570 CDD:292531 32/77 (42%)
C2H2 Zn finger 495..515 CDD:275368 6/19 (32%)
zf-H2C2_2 507..531 CDD:290200 10/23 (43%)
C2H2 Zn finger 523..543 CDD:275368 11/19 (58%)
zf-H2C2_2 536..560 CDD:290200 13/23 (57%)
C2H2 Zn finger 551..571 CDD:275368 6/19 (32%)
znf329NP_001123794.2 KRAB_A-box 96..127 CDD:143639
C2H2 Zn finger 268..288 CDD:275368 3/9 (33%)
COG5048 <292..446 CDD:227381 57/137 (42%)
C2H2 Zn finger 296..316 CDD:275368 8/19 (42%)
C2H2 Zn finger 324..344 CDD:275368 7/19 (37%)
C2H2 Zn finger 352..372 CDD:275368 6/19 (32%)
C2H2 Zn finger 380..400 CDD:275368 11/19 (58%)
C2H2 Zn finger 408..428 CDD:275368 6/19 (32%)
C2H2 Zn finger 436..456 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.