DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nup43 and NEDD1

DIOPT Version :9

Sequence 1:NP_650716.2 Gene:Nup43 / 42209 FlyBaseID:FBgn0038609 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001119176.1 Gene:NEDD1 / 830483 AraportID:AT5G05970 Length:782 Species:Arabidopsis thaliana


Alignment Length:276 Identity:59/276 - (21%)
Similarity:100/276 - (36%) Gaps:74/276 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VRLWRLQSNQYVTATDSEVDQIPRCMDKVR-MEDDVTAMEFVDKDT-LAVSCADGHLSVFNV--- 102
            |::|.||..              .|:.|:: ....:|.:.:..||. ||.....|.|.|.|:   
plant   117 VKIWDLQRK--------------LCIKKLKGHTSTITGVMYNCKDEHLASVSVGGDLIVHNLASG 167

  Fly   103 HRAVE----EDQMQRT---SRSGRLHCFQRSQEPAPCTDLSVYGTDIATAGEDGCVSIVSVENVR 160
            .||.|    ..|:.|.   |||.| |.                   :.|||:||.|.:.......
plant   168 ARATELKDPNGQVLRLLDYSRSSR-HL-------------------LVTAGDDGTVHLWDTTGRS 212

  Fly   161 QVKRQIEADSMALFSICYISQQELVTANRMGVIRMLDARVAT--EAQPKTTFMVASQDDKSNFVS 223
            .....::..|.....:|:....|.:.|: :|    :|.::.|  ....:::..:|.:..    .|
plant   213 PKMSWLKQHSAPTAGVCFSPSNEKIIAS-VG----MDKKLYTYDSGSRRSSSCIAYEAP----FS 268

  Fly   224 SLAKHPMQQHILLCGSEEGSITVWDMRNLSYPASYLSA--HKSPINEIGFHQKDP----SKLFTA 282
            ||| .....:||:.|:..|.:..:|:|....|.:.|.|  :...:..:.:....|    .|.:| 
plant   269 SLA-FGDNGYILVAGTSNGRVVFYDIRGKPQPVTVLHAFSNSEDVTSLSWQTSKPVIVNEKNYT- 331

  Fly   283 AEGGEVWMWSENKVLG 298
                     ||..:||
plant   332 ---------SEMALLG 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nup43NP_650716.2 WD40 repeat 16..73 CDD:293791 6/30 (20%)
WD40 74..347 CDD:295369 53/244 (22%)
WD40 repeat 77..125 CDD:293791 19/58 (33%)
WD40 repeat 133..166 CDD:293791 6/32 (19%)
WD40 <142..344 CDD:225201 34/165 (21%)
WD40 repeat 173..211 CDD:293791 6/39 (15%)
WD40 repeat 222..263 CDD:293791 13/42 (31%)
WD40 repeat 266..291 CDD:293791 3/28 (11%)
NEDD1NP_001119176.1 WD40 46..>326 CDD:225201 53/252 (21%)
WD40 46..325 CDD:295369 53/251 (21%)
WD40 repeat 48..100 CDD:293791
WD40 repeat 138..174 CDD:293791 12/35 (34%)
WD40 repeat 182..218 CDD:293791 12/55 (22%)
WD40 repeat 267..305 CDD:293791 12/38 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.